KEGG   Haloferax gibbonsii: ABY42_09705Help
Entry
ABY42_09705       CDS       T04025                                 

Definition
(GenBank) tRNA (pseudouridine-N1)-methyltransferase
  KO
K16317  tRNA (pseudouridine54-N1)-methyltransferase [EC:2.1.1.257]
Organism
hgi  Haloferax gibbonsii
Brite
KEGG Orthology (KO) [BR:hgi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hgi03016]
    ABY42_09705
Enzymes [BR:hgi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.257  tRNA (pseudouridine54-N1)-methyltransferase
     ABY42_09705
Transfer RNA biogenesis [BR:hgi03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    ABY42_09705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltrn_RNA_2
Motif
Other DBs
NCBI-ProteinID: AKU09082
UniProt: A0A0K1IX07
Position
1865225..1865821
Genome map
AA seq 198 aa AA seqDB search
MRQFIVIGHDAPTTPDFSLDDIAGGAGRLDVLCRCVNAAFFLSHDIREDVRVHLVLGDEY
TVRFEGSELRRLNPDERSTAALIRKALEKREEAIGHMPAESSPGVSIRRMGFETTLEEAA
RDATVVELHEEGDPVVQVEPPENPLFVLSDHHDFTDEEAELLAAAADERVRLGPEILHAD
HSITVAHNYLDTAGYSRY
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaattcatcgtcatcggccacgacgcgccgacgacgcccgacttctcgctcgac
gacatcgccggcggggccggccgactcgacgtgctctgtcgctgtgtcaacgccgcgttc
ttcctctcgcacgacatccgcgaggacgttcgggttcatctggtcctcggcgacgagtac
accgtccggttcgaaggttcggaactccgtcggctcaaccccgacgagcgctccaccgcc
gccctgattcgcaaggcgctggagaagcgcgaggaggcaatcgggcacatgcccgccgag
tcgtcgccgggggtctccatccgccggatgggcttcgagacgacgctggaggaggccgcc
cgcgacgcgaccgtggtcgaactccacgaggagggcgaccccgtggttcaggtcgaaccg
cccgaaaacccgcttttcgtcctctcggaccaccacgacttcaccgacgaggaggccgag
ttgctggcggccgccgccgacgagcgggtccgactcggtcccgagattctccacgccgac
cactcgattacggtcgcgcacaactacctcgataccgcgggctattcgcggtactga

DBGET integrated database retrieval system