KEGG   Haloferax gibbonsii: ABY42_11505Help
Entry
ABY42_11505       CDS       T04025                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
hgi  Haloferax gibbonsii
Pathway
hgi00860  Porphyrin and chlorophyll metabolism
hgi01100  Metabolic pathways
hgi01110  Biosynthesis of secondary metabolites
hgi01120  Microbial metabolism in diverse environments
Module
hgi_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:hgi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ABY42_11505
Enzymes [BR:hgi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     ABY42_11505
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     ABY42_11505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M DUF3305 CysG_dimeriser
Motif
Other DBs
NCBI-ProteinID: AKU08324
UniProt: A0A0K1IV67
Position
complement(2263009..2263656)
Genome map
AA seq 215 aa AA seqDB search
MIPLVHDLSDETVVVFGGGPVGARKARRFAREARTVVVSPEFADRDFGDAERVRAAPAPD
EVPDWVERFAPALVVAATDDDAVNDAVVAAARDAGALVNRADRSGERDAGSVVVPATVED
GDVSVAITTGGASPALSKHLRERVEAELEGAGEMAALTAELRAELKASDRSPAERRDAIR
AVVRDPSVWKALRTGDANPRQEAARVIRDTQRGDS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgattccgcttgtccacgacctctccgacgagacggtcgtcgtcttcggcgggggaccc
gtcggcgcgcggaaggcccgtcggttcgcccgcgaggcgcggaccgtcgtcgtcagcccc
gagttcgccgaccgcgacttcggcgacgcggagcgcgttcgggcggcccccgcgcccgac
gaggttcccgactgggtcgagcggttcgccccggcgctcgtcgtcgcggcgaccgacgac
gacgcggtgaacgacgccgtcgtcgcggcggcccgagacgccggcgcactggtcaatcga
gccgaccggagcggcgagcgcgacgcggggagcgtggtcgtcccggcgaccgtcgaggac
ggcgacgtgtcggtcgccatcacgaccggcggcgcgagccccgccctctcgaagcacctc
cgagagcgcgtcgaagccgagttggagggagcgggcgagatggccgcgctgaccgcggaa
ctccgcgcggaactcaaggcgtccgaccggtcgccggccgagcgccgtgatgcgattcga
gcggtcgtgcgagacccgtcggtttggaaggctttacgtaccggcgatgcaaacccccgc
caagaggcagcgcgcgtgatacgagacacacagcgaggtgattcatga

DBGET integrated database retrieval system