KEGG   Haloferax gibbonsii: ABY42_16395Help
Entry
ABY42_16395       CDS       T04025                                 

Definition
(GenBank) methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
hgi  Haloferax gibbonsii
Pathway
hgi00630  Glyoxylate and dicarboxylate metabolism
hgi00660  C5-Branched dibasic acid metabolism
hgi01100  Metabolic pathways
hgi01120  Microbial metabolism in diverse environments
hgi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ABY42_16395
   00660 C5-Branched dibasic acid metabolism
    ABY42_16395
Enzymes [BR:hgi01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     ABY42_16395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C MR_MLE_N Enolase_C
Motif
Other DBs
NCBI-ProteinID: AKU09375
UniProt: A0A0K1IYI9
Position
pHG1:317974..319236
Genome map
AA seq 420 aa AA seqDB search
MPTIADVSAIPTAGGFYFDDKEAITRNATTDGFSYTGQPVTDGFSRVRQPAEALSIVVEL
DNGRYGTGDCAAVQYSGFGGRDPFFDAQAHADLVESTLADAFVGRDAGDFTGNVAAIQDS
IESGDPLHTAVRYGFSQALLDAAAEAHSTTMTEVIIDEYGLSHTPEPVPIFTQTGDSRRQ
NAEKMILKGVPVLPHGLFNSVEKTGRDGERLLEYLSWLSDRVAELGAPGYEPVFHVDVYG
TIGEIFGPPYGRTEVVEYFAALQEAAAPYTLQVESPIEADSRDEQITVLGALRDGLADAA
VPVSIVADEWCNTYDDITAFVDAGAVDVVQIKTPDLGELTESIAAVQYCEGTGTGAYLGG
SCAETDVSARVCTHVALATQPIQLLARPGMGVDEAYMIVQNEMTRTLNRIVTQDQQAALQ
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgatagcagacgttagcgcgatcccgacagccggtggcttttatttcgatgat
aaagaggccatcactcggaacgccacgacagatgggttttcctatacaggacagccagtg
accgacggcttctcacgcgttcggcaacccgccgaggctctgagtatcgtcgttgagctg
gataacgggcgctatggtaccggcgactgcgcagcagttcagtactccggattcggtggg
cgcgacccattcttcgacgcgcaagcccacgctgacctcgtggaatcgacacttgctgat
gcattcgtcggccgggatgcgggtgatttcaccggcaacgtggcagccatccaagacagc
attgaatcaggagatccacttcacaccgctgttcgctacggattttcccaagcgctactt
gatgcggcggcagaggcccattcaacaacaatgaccgaggtgattatcgacgagtacggc
ttgtctcatacgcctgagccggttcctattttcacgcagacgggtgatagccggcgtcaa
aacgcggagaaaatgattctcaaaggcgtcccggtacttccacatggactcttcaactcg
gtcgagaaaacagggcgcgatggggagcggcttttggagtatctgtcgtggttgagcgac
cgggtagcggaactcggtgcacccggatatgagccggtgtttcacgtagacgtatacggg
actatcggggagatatttggtccgccgtacggccgcaccgaggtggtcgagtacttcgct
gcgctccaagaagccgcggcaccgtacacacttcaggtggaaagtccgatcgaagccgac
tctcgagacgaacagatcaccgtacttggtgcgctccgagatggactcgccgacgcagcc
gttccagtttcgatcgtcgcagacgagtggtgtaacacctatgacgatatcaccgcgttc
gtcgacgccggcgcagtagatgttgtgcagatcaagacacctgatcttggagaactcaca
gagagtattgctgcggtccaatactgcgaggggacggggacgggtgcatatcttgggggt
agctgtgcggaaaccgacgtctccgcacgcgtctgcacgcacgtggccctcgccactcag
ccgattcaactactcgccagaccggggatgggtgttgacgaagcgtacatgatcgtacag
aacgaaatgacacggacactcaatcggatcgtaactcaggaccagcaagccgcacttcag
taa

DBGET integrated database retrieval system