KEGG   Heterocephalus glaber (naked mole rat): 101696358
Entry
101696358         CDS       T02812                                 

Gene name
Mbd3
Definition
(RefSeq) methyl-CpG binding domain protein 3
  KO
K11591  methyl-CpG-binding domain protein 3
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hgl03036]
    101696358 (Mbd3)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    101696358 (Mbd3)
  Chromatin remodeling factors
   NuRD complex
    101696358 (Mbd3)
SSDB
Motif
Pfam: MBD_C MBDa MBD RasGAP
Other DBs
NCBI-GeneID: 101696358
NCBI-ProteinID: XP_004865995
UniProt: A0A0P6JFQ5
Position
Un
AA seq 290 aa
MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLS
TFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPS
NKVKSDPQKAVDQPRQLFWEKKLSGLSAFDIAEELVRTMDLPKGLQGVGPGCTDETLLSA
IASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLE
EALMADMLAHVEELARDEAPLDKACGDEEDEEDEEDEEEEPEPDPELERV
NT seq 873 nt   +upstreamnt  +downstreamnt
atggagcggaagaggtgggagtgcccggcgctcccgcagggctgggagagggaagaagtg
cccagaaggtcggggctgtcggccggccacagggatgtcttttactatagccccagcggg
aagaagttccgaagcaagccccagctggcgcgctacctgggcggctccatggacctgagc
accttcgacttccgcacgggcaagatgctgatgagcaagatgaacaagagccgccagcgc
gtgcgctacgactcctccaaccaggtcaagggcaagcccgacctcaacacggcgctgccg
gtgcggcagacggcgtccatcttcaagcagccggtgaccaagatcaccaaccaccccagc
aacaaggtcaagagtgatccacagaaggctgtggaccagcctcggcagctgttctgggag
aagaagctaagcgggctgagcgcctttgacattgcggaggagctggtcaggaccatggac
ctgcccaaggggctgcagggggtgggccccggctgcacagatgagaccctgctctctgcc
atcgccagtgccctgcacaccagcaccatgccaatcacaggccagctctcggctgccgtg
gagaagaaccctggcgtgtggctgaacaccacgcagcccctgtgcaaagccttcatggtg
accgatgaagatatcaggaagcaagaggagttggtgcagcaggtgcggaagcggctggag
gaggcactgatggctgacatgctggcccatgtggaggagctggctcgtgacgaggcgccc
ttggacaaggcctgcggggatgaggaggatgaggaggatgaggaagatgaggaggaggag
cccgagccagacccggagctggagcgcgtctag

DBGET integrated database retrieval system