KEGG   Heterocephalus glaber (naked mole rat): 101697469Help
Entry
101697469         CDS       T02812                                 

Gene name
Alpi
Definition
(RefSeq) intestinal-type alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00730  Thiamine metabolism
hgl00790  Folate biosynthesis
hgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    101697469 (Alpi)
   00790 Folate biosynthesis
    101697469 (Alpi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hgl04147]
    101697469 (Alpi)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hgl00537]
    101697469 (Alpi)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101697469 (Alpi)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101697469 (Alpi)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hgl00537]
 Enzymes
  101697469 (Alpi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 101697469
NCBI-ProteinID: XP_004868187
Position
Un
AA seq 541 aa AA seqDB search
MQGAQALLLLPLLLLGLRLRLTLGIIPEEEENPDFWNQKGNEALAAAKKLQPIQTAAKNL
ILFLGDGMGVSTVTATRILKGQMQGHLGPETPLTMDRFPYMALSKTYSVDRQVPDSASTA
TAYLCGVKTNYKTIGVSAAARFAQCNTTWGNEVTSVMYQAKKAGKSVGIVTTTRVQHASP
AGTYAHTVNRNWYSDADMPASARQEGCRDIATQLVSNMDIDVILGGGRKYMFPLGTRDPE
YPDDANSTGARQDGKDLVQEWLSKHEGSQYVWNRTELLRVSQDPSVTRLMGLFEPSDTKF
EISRDPELDPSLAEMTEAALHVLSRNPNGFYLFVEGGRIDRGHHEGSAYRALTEAVMFDS
AIDKAGQLTSEQDTLTLITADHSHVFTFGGYTLRGTSIFGLAPRLAEDGKTYTSILYGNG
PGYVGDKGPRPNVTAEESGNPTYQQQSAVPVQSETHGGEDVAVFARGPQAHLMHGVQEQS
YIAHLMAFAGCLEPYTACGLPPPGHSAATDAPADASADAAPPSLALLAGTALLLLGETAA
P
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcagggagcccaggcgctgctgctgctgccactgctgctgctgggcctcaggctacgg
ctgacccttggcatcatcccagaggaggaggagaacccggacttctggaaccaaaaagga
aatgaggccttggcagctgctaagaagctgcagcccattcagactgcggccaagaacctc
atcctcttcctgggggacgggatgggggtgtccacggtgaccgccaccaggatcctgaag
gggcagatgcagggccacctgggaccagagacgcctctgaccatggatcgattcccatac
atggcgctgtccaagacctacagtgtggacagacaggtgccagacagcgcaagcacagcc
accgcatacctatgtggggtcaagaccaactacaagaccatcggtgtgagcgctgccgcc
cgctttgcccagtgcaacacaacctggggcaatgaggtcacctctgtgatgtaccaggcc
aagaaagcagggaagtctgtcggaatcgtgaccaccaccagggtccagcacgcctcgccg
gcaggcacctatgcacacaccgtgaaccgcaactggtactcggacgccgacatgcccgcc
tcagcgcgccaggagggctgccgggacatcgccacgcagctcgtctccaacatggacatt
gatgtgatcctgggtgggggccggaaatacatgtttcccttggggaccagagaccctgag
tatccagatgatgccaactccacgggagccaggcaggacgggaaggacctggtgcaggag
tggctgtccaagcacgagggctctcagtacgtgtggaaccgcacagagctgctccgggtg
tcccaggacccgtccgtgacccgcctcatgggcctttttgagccttctgacacaaaattt
gagatctcccgagaccctgagctggacccgtccctggcggagatgacagaggcagccctg
cacgtgctgagcaggaaccccaacggcttctacctcttcgtggaggggggccgcatcgac
cgtggtcaccacgagggctcagcctaccgagcactcaccgaggcggtcatgttcgactct
gccatcgacaaggccgggcagctcaccagcgagcaggacaccctgaccctcatcaccgcc
gaccactcccacgtcttcacgttcgggggctacaccctgcgggggacctccatcttcggg
ttggcccctcgcctggctgaggacggcaagacctacacctccatcctatacggcaacggc
ccaggctacgtcggggacaagggtccccggcccaatgtcaccgcggaggagagcggcaac
cccacctaccagcagcagtcggcagtgcctgtgcaatcggagacccacggcggcgaggac
gtggcggtgttcgcgcgcggcccgcaggcgcacctcatgcacggcgtgcaggagcagagc
tacatcgcgcacctcatggccttcgccggctgcctggagccctacaccgcctgcggcctg
ccgccgcccggccacagcgcagccacggacgcccccgcggacgccagcgcggacgctgcg
ccgccttccctggcgctgttggccgggaccgcgctgctcctgctgggggagaccgctgcg
ccctga

DBGET integrated database retrieval system