KEGG   Heterocephalus glaber (naked mole rat): 101697518
Entry
101697518         CDS       T02812                                 

Gene name
Polr2g
Definition
(RefSeq) RNA polymerase II subunit G
  KO
K03015  DNA-directed RNA polymerase II subunit RPB7
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl03020  RNA polymerase
hgl05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    101697518 (Polr2g)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    101697518 (Polr2g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hgl03021]
    101697518 (Polr2g)
   03019 Messenger RNA biogenesis [BR:hgl03019]
    101697518 (Polr2g)
   03400 DNA repair and recombination proteins [BR:hgl03400]
    101697518 (Polr2g)
Transcription machinery [BR:hgl03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     101697518 (Polr2g)
Messenger RNA biogenesis [BR:hgl03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     101697518 (Polr2g)
DNA repair and recombination proteins [BR:hgl03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      101697518 (Polr2g)
SSDB
Motif
Pfam: S1 SHS2_Rpb7-N
Other DBs
NCBI-GeneID: 101697518
NCBI-ProteinID: XP_004874457
UniProt: A0A0P6J5D6
Position
Un
AA seq 172 aa
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS
NT seq 519 nt   +upstreamnt  +downstreamnt
atgttttaccacatctccctggagcacgagatcctgctgcatccgcgctactttggcccc
aacctgctcaacacggtgaagcagaagctgttcaccgaggtggaggggacctgcacgggg
aagtatggttttgtcattgctgtcaccaccatcgacaacattggtgctggtgtgatccag
ccaggccggggctttgtcctctacccggttaaatacaaggccattgtcttcaggcccttt
aaaggcgaggtcgtggatgctgtggtcactcaggtcaacaaggttggcctcttcacagaa
attgggcccatgtcttgcttcatctctcggcactccatcccatccgagatggagtttgat
cccaattccaacccgccctgctacaagacaatggatgaggacattgtcattcagcaggac
gatgagatccgcctgaagattgtggggacccgcgtggacaagaacgacatttttgcgatt
ggctccctgatggatgattacctggggcttgtaagctga

DBGET integrated database retrieval system