KEGG   Heterocephalus glaber (naked mole rat): 101697555Help
Entry
101697555         CDS       T02812                                 

Gene name
Ddc
Definition
(RefSeq) dopa decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00350  Tyrosine metabolism
hgl00360  Phenylalanine metabolism
hgl00380  Tryptophan metabolism
hgl01100  Metabolic pathways
hgl04726  Serotonergic synapse
hgl04728  Dopaminergic synapse
hgl05030  Cocaine addiction
hgl05031  Amphetamine addiction
hgl05034  Alcoholism
Module
hgl_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
hgl_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101697555 (Ddc)
   00360 Phenylalanine metabolism
    101697555 (Ddc)
   00380 Tryptophan metabolism
    101697555 (Ddc)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    101697555 (Ddc)
   04726 Serotonergic synapse
    101697555 (Ddc)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    101697555 (Ddc)
   05031 Amphetamine addiction
    101697555 (Ddc)
   05034 Alcoholism
    101697555 (Ddc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hgl04147]
    101697555 (Ddc)
Enzymes [BR:hgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     101697555 (Ddc)
    4.1.1.105  L-tryptophan decarboxylase
     101697555 (Ddc)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101697555 (Ddc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101697555
NCBI-ProteinID: XP_004839911
Position
Un
AA seq 506 aa AA seqDB search
MAPVQEVAPTEAAPPLEFLPGLNPVTMNTSEFRRRGKEMVDYMADYLEGIERRPVYPAVE
PGYLRTLIPSSAPEEPEAYEDILGDIERIIMPGVTHWHSPYFFAYFPTASSYPALLADML
CGAIGCIGFSWAASPACTELETVMMDWLGKMLQLPDAFLAGSAGMGGGVIQGSASEATLV
ALLAARTKVTRQLQATFPELTQAAIMERLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGN
FAMRASALQEALERDKASGLIPFFVVATLGTTNCCSFDNLLEVGPLCNKERVWLHIDAAY
AGSAFICPEFRHLLDGVEFADSFNFNPHKWLLVNFDCSAMWVKQRTDLIGAFKLDPVYLM
HGHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRTYGVKGLQAYIRKHVQLAREFESLVRQ
DPRFEICMEVILGLVCFRLKGSNQLNETLLKRINGARKIHLVPCHLRDKFVLRFAICSRE
VESAHVQQAWEHIRELAEDILKPERA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggcaccagtacaggaagtggcaccgacagaggcagcgccccccttggagtttctgcct
ggcctgaaccccgtgaccatgaacaccagtgagttccgaaggagagggaaggagatggtc
gactacatggctgactacctggaaggcatcgagaggcgcccggtctaccccgcagtggag
cccggctacctgaggacactgatccccagcagtgccccggaggagccagaggcgtatgag
gacatcctgggggacattgagaggataatcatgccgggggtgactcactggcacagcccc
tacttcttcgcctacttccccacggccagctcctacccggccctgctggcggacatgctg
tgtggggccatcggctgcatcggcttctcctgggcagccagcccagcgtgcacggagctg
gagacggtgatgatggactggctggggaagatgctgcagctgccggatgccttcctggct
gggtctgcgggcatgggtggaggcgtgatccaggggagtgccagtgaagccacgctggtg
gccctattggctgctcggaccaaagtgacccgacagctgcaggccaccttcccggagctg
acacaggccgccatcatggagaggctggtggcctactcatccgaccaggcacactcctcg
gtggaaagggccggactcatcggtggggtgaaactaaaagccatcccttcagacggcaac
ttcgccatgcgagcttccgccctgcaggaggccttggagcgagacaaggcaagcggcctg
attcccttcttcgtggtggccacgctggggacgacaaactgctgctccttcgacaacctc
ctagaagtgggtcctctctgcaacaaggagcgcgtgtggctgcacatcgacgcggcgtac
gcaggcagcgccttcatctgcccggagttccggcacctcctggatggggtggagtttgca
gactcatttaacttcaacccccacaaatggctgttggtgaatttcgactgctccgccatg
tgggtaaaacagaggacagacctaataggagcctttaaactggaccctgtttacctgatg
catggccatcaggattcaggacttatcactgactacaggcactggcaaatccccctgggc
cggagattccgatctttgaaaatgtggtttgtcttcagaacttacggagtcaaagggctg
caggcgtacattcgaaagcacgtgcagctggctcgcgagttcgagtccttggtgcgccag
gacccccgctttgagatctgcatggaggtcattctggggctggtctgcttccggctcaag
ggttccaaccagttgaatgagacgctcctgaaaagaataaatggcgccaggaaaatccac
ctggtcccgtgtcacctgcgggacaagttcgtgctgcgctttgccatctgctcccgagag
gtggaatctgcccacgtgcagcaggcctgggaacacatccgggagctggcggaggacata
ctgaagccagagagggcctga

DBGET integrated database retrieval system