KEGG   Heterocephalus glaber (naked mole rat): 101698230Help
Entry
101698230         CDS       T02812                                 

Gene name
Cd9
Definition
(RefSeq) CD9 molecule
  KO
K06460  CD9 antigen
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101698230 (Cd9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hgl04147]
    101698230 (Cd9)
   04090 CD molecules [BR:hgl04090]
    101698230 (Cd9)
Exosome [BR:hgl04147]
 Exosomal proteins
  Proteins found in most exosomes
   101698230 (Cd9)
CD molecules [BR:hgl04090]
 Proteins
  101698230 (Cd9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspannin IBV_3C
Motif
Other DBs
NCBI-GeneID: 101698230
NCBI-ProteinID: XP_004869436
UniProt: A0A0P6JFD7
Position
Un
AA seq 227 aa AA seqDB search
MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQDSNSNSSFYTGVY
ILIGAGALMMVVGFLGCCGAVQESQCMLGLFFCFLLVIFGIEVAAAAWGFTHKDEVIKRV
QDFYIDTYSKLKNKDEPQRETLKAIHKALDCCGVVGGIEQFISDICPNNGIINNLKVKPC
PEAIREVFDNKFHIIGAVGIAIAVVMIFGMIFSMILCCAIRRDRGMV
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcaaaggaggttccaagtgcatcaaatacctgctcttcgggtttaacttcatc
ttctggcttgccgggattgcagtccttgccattggactatggctccgattcgactcccag
accaagagcatcttcgagcaggactcgaatagtaactccagcttctacacaggagtctac
attctgattggagccggggccctcatgatggtggtgggtttcttgggctgctgtggggct
gtgcaggagtcccagtgcatgctgggattgttcttttgcttcctcttggtgatatttggt
attgaagtagctgcagccgcctggggctttacccacaaggatgaggtgattaagcgtgtg
caggacttttacatcgacacctacagcaagctgaaaaacaaggatgagccccagcgggaa
acgctgaaagccatccacaaagcgctggactgctgtggcgttgtgggaggcatagagcag
ttcatctcggacatctgccccaacaatggcatcatcaacaacctcaaagtcaagccctgc
cccgaggccatcagagaggtcttcgacaacaagttccacatcattggtgccgtgggcatt
gccatcgccgtggtgatgatatttggcatgatcttcagcatgatcctgtgctgtgcaatc
cgcagagaccgaggcatggtctag

DBGET integrated database retrieval system