KEGG   Heterocephalus glaber (naked mole rat): 101698642Help
Entry
101698642         CDS       T02812                                 

Gene name
Faslg
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01524  Platinum drug resistance
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04068  FoxO signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04210  Apoptosis
hgl04217  Necroptosis
hgl04650  Natural killer cell mediated cytotoxicity
hgl04722  Neurotrophin signaling pathway
hgl04932  Non-alcoholic fatty liver disease (NAFLD)
hgl04940  Type I diabetes mellitus
hgl05142  Chagas disease (American trypanosomiasis)
hgl05143  African trypanosomiasis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05320  Autoimmune thyroid disease
hgl05330  Allograft rejection
hgl05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101698642 (Faslg)
   04010 MAPK signaling pathway
    101698642 (Faslg)
   04068 FoxO signaling pathway
    101698642 (Faslg)
   04151 PI3K-Akt signaling pathway
    101698642 (Faslg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101698642 (Faslg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101698642 (Faslg)
   04217 Necroptosis
    101698642 (Faslg)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101698642 (Faslg)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101698642 (Faslg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101698642 (Faslg)
   05205 Proteoglycans in cancer
    101698642 (Faslg)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101698642 (Faslg)
   05330 Allograft rejection
    101698642 (Faslg)
   05332 Graft-versus-host disease
    101698642 (Faslg)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101698642 (Faslg)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101698642 (Faslg)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101698642 (Faslg)
   05162 Measles
    101698642 (Faslg)
   05164 Influenza A
    101698642 (Faslg)
   05161 Hepatitis B
    101698642 (Faslg)
   05160 Hepatitis C
    101698642 (Faslg)
   05168 Herpes simplex virus 1 infection
    101698642 (Faslg)
   05163 Human cytomegalovirus infection
    101698642 (Faslg)
   05165 Human papillomavirus infection
    101698642 (Faslg)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    101698642 (Faslg)
   05143 African trypanosomiasis
    101698642 (Faslg)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101698642 (Faslg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hgl04147]
    101698642 (Faslg)
   04052 Cytokines and growth factors [BR:hgl04052]
    101698642 (Faslg)
   04090 CD molecules [BR:hgl04090]
    101698642 (Faslg)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101698642 (Faslg)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Tumor necrosis fators
   101698642 (Faslg)
CD molecules [BR:hgl04090]
 Proteins
  101698642 (Faslg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF RskA DUF5345
Motif
Other DBs
NCBI-GeneID: 101698642
NCBI-ProteinID: XP_004853480
Position
Un
AA seq 276 aa AA seqDB search
MQQHPNYPYPQIYWINDSTSSAWAPPESVFPCLSSRPGQRRPPPPPPPPPPPPPPPPPPP
PPLPPSKERRDRHRDLYLFVMFSMVLVALVGLGLGMYQLFHLQKELAELREVTSQSHTES
SLEKQIGHSGSPSEKKELRRVAHLTGKLYSRSIPLEWEDTYGIALISGVKYKEGSLVIND
TGLYFVYSKVYFRGQSCDNQPLSHKVYTRNSRYHQDLVLMEGKMMSYCTTGQMWAHSSYL
GAVFNLTSADHLYVNVSELSLVNFEESKTFFGLYKL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcacccaaattacccatatccccagatctactggataaatgacagtaccagc
tctgcctgggcccctccagagtcagttttcccctgtctgtcctctaggcctggtcaaagg
aggccaccgccaccgccaccaccaccaccaccaccaccaccaccaccaccaccgccaccg
ccaccactgccaccttcaaaggagaggcgggaccgccacagagacttgtatctctttgtg
atgttttccatggtgctcgtggccctggttggactggggctgggaatgtatcaactcttc
cacctacagaaggagctagcagagctccgggaggtcaccagccaaagtcatacagaatca
tctctggagaagcagataggacactctggttcgccctctgaaaaaaaggagctgaggaga
gtcgcccatctaacaggcaagctctactcacggtccatccctctggaatgggaagacacc
tatggaattgccctgatctcgggagtgaagtataaggagggtagccttgtgatcaatgac
actgggctatactttgtatattccaaagtatatttccggggtcagtcttgcgacaatcag
cccctgagccacaaggtctacacaaggaactctaggtatcaccaggatctggtgctgatg
gaggggaagatgatgagctactgtactactggccagatgtgggcccatagcagttacttg
ggagcagtgttcaatctcaccagtgctgaccatttatatgtcaacgtctcagagctctct
ctggtcaattttgaggaatcaaagacattttttggcttatataaactctag

DBGET integrated database retrieval system