KEGG   Heterocephalus glaber (naked mole rat): 101699033
Entry
101699033         CDS       T02812                                 

Gene name
Lgals9, Galectin-9
Definition
(RefSeq) galectin 9
  KO
K10093  galectin-9
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hgl04091]
    101699033 (Lgals9)
Lectins [BR:hgl04091]
 S-type lectins (Galectins)
  101699033 (Lgals9)
SSDB
Motif
Pfam: Gal-bind_lectin
Other DBs
NCBI-GeneID: 101699033
NCBI-ProteinID: XP_004857020
UniProt: G5BVM8
Position
Un
AA seq 337 aa
MAFSSPQPPYVSPAVPFSGVIQGGLQEGLQITVQGTILHSNTNRFSVNFQTGFSDNDIAF
HFNPRFEEGGYVVCNTKQKGNWGPEERKIQMPFQKGKAFELCFLVQRSEFKVMVNKRFFV
QYPHRVPFHLADTISVAGPLQLSYISFQNFPVQPAFSMPQFSQPVRFPQKSRRYRPKTQP
IMHGIPGLVFSNPELSPIMDPNLNYPIPYFTSIPGGLFPSRVITVSGIIPPNAKRFHINL
RCGSDVAFHLNPRFDQNTVVRNTQIKGCWGSEERSLPFKMPFRQGQGFLVGIICEGYCYR
VTVDGQYLLEYTHRLKDLRAINNLEVAGDIELTNVHT
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggctttttctagcccccaaccaccctacgtgagcccggctgttcctttttctggggtg
atccaaggaggtctccaggagggtcttcagatcactgtccagggaaccattcttcactcc
aacacaaacaggttctcggtgaacttccagactggcttcagtgacaatgacattgccttc
cacttcaacccacggtttgaagagggagggtatgttgtttgcaatacaaagcagaaagga
aattgggggccagaggagaggaagatacaaatgcctttccagaaggggaaggcctttgag
ctctgcttcctggtgcagagatcggagttcaaggtgatggtgaacaagagattctttgtg
cagtacccacaccgagtgccctttcatcttgcggacaccatctctgttgctggccctttg
cagctgtcctacatcagcttccagaacttccccgtgcagcctgccttctccatgccacaa
ttctcccagcctgtgcgtttcccacagaagtccaggaggtacagaccgaaaactcaaccc
atcatgcacggtatccctggactggtgttctctaatcctgaactatcacctataatggac
cccaacctaaactatcccattccttacttcacctccatcccaggtgggctgttcccatct
agggtcatcactgtgtccggcattatcccacccaatgctaagaggttccacatcaacctg
cgctgtgggagtgacgttgccttccacctgaacccacgttttgatcaaaacactgtggtc
cgaaacactcagatcaagggctgctggggttcagaagagcgaagcctgcccttcaaaatg
cccttcagacaaggccagggcttcttggtggggatcatatgcgaaggttactgctacagg
gtgactgtggatggccaatacctgctggaatacacccaccgcctgaaggacctgagggcc
atcaataacctagaagtggctggtgacattgagctgaccaatgtgcacacctag

DBGET integrated database retrieval system