KEGG   Heterocephalus glaber (naked mole rat): 101699579
Entry
101699579         CDS       T02812                                 

Gene name
Tm7sf2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00100  Steroid biosynthesis
hgl01100  Metabolic pathways
Module
hgl_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    101699579 (Tm7sf2)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     101699579 (Tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 101699579
NCBI-ProteinID: XP_004852481
UniProt: A0A0P6JE93
Position
Un
AA seq 417 aa
MASQGPQAPLEFGGPLGAAALMLLLPATTIHLLLVARSGPARLLGPPPHLPGLSALWSPP
ALLLLLTWLGLQAALYLLPARKVTEGLELKDKSRLRYPINGFQALVLTALLVGLGLSVGL
PLGMLSDMLLPLAFTTTLTTFIFSFLLYMKAQMAPPSGLAPGGNSGNTIYDFFMGRELNP
RICSFDFKYFCELRPGLIGWVLINLALLMQEAELRGSPSLAMWLVNGFQLLYVGDALWHE
EAVLTTMDITHDGFGFMLAFGDLVWVPFTYSLQAQFLLHHPQPLGPPTALVICLINAVGY
YIFRGANSQKNTFRKNPSDPSVAGLETIPTATGKRLLVSGWWGMVRHPNYLGDLVMALAW
SLPCGLSHLLPYFYFLYFLALLVHREARDERQCLQKYGRAWQEYCQRVPYRIIPYIY
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcctctcagggtccccaggccccactggaattcggggggcccctgggcgccgcggcg
ctcatgctgctgttgcccgccaccacgatccacctgctcctggtggcccgctccggccca
gctcgcctcctgggtccacccccgcacctgcccgggctctcagcgctgtggagccctcca
gcgctgctgctgttgctcacctggctcggcctacaggcagcgctctatctgctgccggcg
cgcaaggtgacggaggggctggagttgaaggacaagagtcgcctgcgctatcctattaac
ggcttccaggccctggtgctgacagccctattggtggggctggggctgtctgtgggactt
cccctggggatgctctcggacatgctgctgcccttggcgttcacgaccaccctcaccacc
ttcatcttcagcttccttctctatatgaaggcccagatggcccctccctcgggcctggca
cctgggggaaactcaggcaacaccatttacgacttcttcatgggacgggagctgaaccct
cgaatttgttcctttgacttcaaatatttctgcgagctgaggcctggcctcattggctgg
gtcctcatcaacctggcccttcttatgcaggaggcggagctgcgggggagcccctccctg
gccatgtggctggtaaatggcttccagctgctgtatgtgggcgatgccctctggcatgag
gaggctgtcctcaccaccatggacatcacccatgatgggtttggcttcatgctggcattt
ggcgacctagtctgggtacccttcacctacagcctgcaggctcaattcctgctccaccac
ccacagcccctggggccgcccaccgccttggtcatttgcctcatcaatgccgttggttac
tacatttttcgtggggccaattcccagaaaaacactttccggaagaatccttctgacccc
agcgtggctggcctcgagaccatccctacagccacgggaaagaggctgctggtgtctggg
tggtggggtatggtccgccatcccaactaccttggggaccttgtcatggctctggcctgg
tccttgccctgtgggttgtcccacttgctcccctacttctactttctctacttcctcgcg
ttgctggtgcaccgggaggctcgagatgagcggcagtgcctacagaagtacggccgggcc
tggcaggagtactgccagcgtgtgccttaccgtatcataccctacatctactga

DBGET integrated database retrieval system