KEGG   Heterocephalus glaber (naked mole rat): 101701217Help
Entry
101701217         CDS       T02812                                 

Gene name
Cdk10
Definition
(RefSeq) cyclin dependent kinase 10
  KO
K02449  cyclin-dependent kinase 10 [EC:2.7.11.22]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101701217 (Cdk10)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101701217 (Cdk10)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101701217 (Cdk10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase RIO1 Pkinase_fungal Kdo APH
Motif
Other DBs
NCBI-GeneID: 101701217
NCBI-ProteinID: XP_004842688
UniProt: A0A0P6J847
Position
Un
AA seq 360 aa AA seqDB search
MADPDPESEQIRLKCIRKEGFFIVPPEHRLGRCRSVKEFEKLNRIGEGTYGIVYRARDTQ
TDETVALKKVRMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYC
EQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTA
DFGLARASGVPMKPVTPKVVTLWYRAPELLLGTTTQTTSIDMWAVGCILAELLAHKPLLP
GTSEIHQVDLIVQLLGTPSENIWPGFSKLPLVSQYSLRKQPYNNLKHKFPWLSEAGLRLL
NFLFMYDPKKRATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPGVAEGQSKRCKP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcggacccggacccagagtcggagcagatccgcctgaagtgtatccgtaaggagggc
ttcttcattgtgcctccggaacacaggctgggacgatgccggagtgtgaaggagtttgag
aagctgaaccgcattggcgagggcacctatggcattgtgtatcgggcccgggacacccag
acagatgagactgttgccctgaagaaggtgcggatggacaaggagaaggatggcatcccc
atcagcagcctgcgggagatcacgctgctcctgcgcctacgccaccccaacatcgtggag
ctgaaggaggtggtggtggggaaccacctggagagcatcttcctggtgatgggttactgt
gagcaggacctggccagcctcctggaaaacatgcccactcctttctctgaggcccaggtc
aagtgcattgtgctgcaggtgctccggggactccagtacctgcacaggaacttcatcatc
cacagggacctgaaggtctccaatctgctcatgactgacaagggctgtgtgaagacagcg
gactttggcctggcccgggcctctggggtcccaatgaagccagtgactcccaaggtggtc
accctctggtaccgtgcccctgagctgctgctgggaactacgacccagaccaccagcatc
gacatgtgggccgtgggctgcatcctggctgagctgttggcccacaagcccctgctccct
ggcacatctgagatccaccaggttgacctgattgtgcagctgctggggacgcccagcgag
aacatctggccgggcttttccaaactgccactggtcagccagtacagcctgaggaagcag
ccatacaacaacctcaagcacaagttcccatggctctcggaggctgggctgcgtctgctg
aatttcctcttcatgtatgatcccaagaaaagggcaacagcgggggactgcttggagagc
tcttatttcaaggagaagcccctgccctgcgagccagaactcatgcccaccttccctcac
caccgaaataagcgggctgctccaggcgtggcagagggccagagcaaaaggtgcaagccc
tga

DBGET integrated database retrieval system