KEGG   Heterocephalus glaber (naked mole rat): 101701232
Entry
101701232         CDS       T02812                                 

Gene name
Aff3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hgl03021]
    101701232 (Aff3)
Transcription machinery [BR:hgl03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101701232 (Aff3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 101701232
NCBI-ProteinID: XP_004844493
Position
Un
AA seq 1258 aa
MDSFDLALLQEWDLESLWGEDILNQRNDSLVVEFQSSASRCRSVYEPDRNTLRRKERERR
NQETQQDGGTFNSSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGV
PKPGVPQTPVNKIDEHFVADSRAQPQPPSVCSTASSTPAAGPGQQNKRGTVGWQKAGHPP
SDGQQRTAQQGSLRTLLGDGVGRQQPRTKQVCNMEVGLPTQERPPAMAAKHSSAGHCVQN
FPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSTEAGVHCASYRGVPANKPESA
RAKAKLSKFSIPKQGEESRSGESNSCVEEIIREMTWLPPLSAIQAPGKVESSKFAFPNKD
SPLVPSGHNNPKKGDAEPESPDNGASNTSMLEDDLKLSSDEDESEQQAAQRTALRTLSDS
TAVQQTNCRGSVPSSKGSSSGSSSSSGSSSSDSESSSGSDSETESSSSESEGSKPPHYSS
PEVEPASSNKWQLDKWLNKVNPHKPPLLTQSDGPGPEGSQYYPAAGKEDAQDCGKLPDAG
LAVLRDKDVKGVCKEEQRPRTANKAPGSKAAKQKSPPAAVAPAAPPPPAPPGVPTESAPA
PTRRSGAKKPTRRAERSAAADAAIATAAATATACHRPEDAAADTLGPSATAPEPPKARPC
GAGRTSHRKELRAAPCDKRRTRGIGRTVPKSKEFIETESSSSSSSSSESDLESEQEEYPL
SKAQVTTGSATSAGGDQRLKEASGVPGGTGPRAPVGSINARTTSDIAKELEEQFYTLVPF
GRNELLSPLKDSDEIRSLWVKIDLTLLSRIPEHLPQEPGVLSAPAAKDPEVAAPGHALDT
TPEKALPKSKRKRKCDNEDDDREMKKAQGEKESSSRLAASANNTSSANHCNVNINSLAIP
INKNEKMLRSPISPLSDASKHKYSTEDLTSSSRPHGNGVFTSSSSNKKPKADSQLQSHAG
DLTKTAHSSENGVLHNKARSQTEPWSPGSNGHRDCKRQKLVFDDMPRSADYFMQEAKRMK
HKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTH
SGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNTSKAAQAPSPWG
TSGKSTGTPSPMSPNPSPTSSVGSQGSLSGANALSPSTIVSIPQRIHQMAANHVSITNSI
LHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSTHLS
NT seq 3777 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagcccttctccaggaatgggacctcgagtcgctgtggggtgaa
gacatcttaaaccagcggaatgattctctagttgtggagtttcagtcgtcagccagcaga
tgcaggagtgtctatgagccagataggaatacattacggaggaaagaacgagagagaaga
aaccaggaaactcaacaggatggtggcacattcaactccagctactccctcttcagtgag
ccctacaagactaacaagggggatgagctctccaaccggatccagaatactttaggcaat
tatgatgaaatgaaagactttttaactgatagatccaatcagagtcatcttgttggcgtc
cccaaaccaggggttcctcagactcctgtgaacaagatcgatgaacattttgttgcagat
tcaagagcccagccccagcccccatctgtctgtagcactgcatcctccacaccagcagct
ggccccgggcagcagaataagagaggcaccgtgggctggcagaaggctgggcacccaccg
tctgatggccagcagagaacagcacaacagggctctctcaggaccttgcttggagatggt
gttggcagacagcagccacggaccaaacaagtgtgcaacatggaggtggggcttccaacc
caggaaaggccacctgcaatggcagccaaacacagcagtgctggacactgcgttcagaac
tttcctccttccctggcttcaaaacccagcctggtccagcagaaaccaaccgcatatgtg
cgaccaatggatggccaggatcaagctcctgatgagtctcccaagctgaagtcatccaca
gaagctggtgtacactgtgcgtcctacaggggagtcccagccaacaagccagagtcggcc
agggccaaggccaagctttccaagttcagcatccctaagcaaggagaggagagtagatct
ggagaaagcaacagctgtgtggaagaaataatcagggagatgacctggcttccaccactt
tctgctattcaagcacctggcaaagtagaatcaagcaaatttgcatttcccaataaggac
tctccgctggtaccctctggacacaataacccaaagaaaggtgatgctgagccagagagt
ccagacaatggcgcatcgaatacatcaatgctagaagatgaccttaagctaagtagcgat
gaggacgagagtgaacagcaggctgcccagagaacagctctccgaacactatctgacagc
accgcggtccagcagaccaactgcaggggctccgtgccgtccagcaagggcagcagcagc
ggcagtagcagcagcagtggcagctcttccagcgactcggagagcagctcgggatcggac
tcagagactgagagcagctccagcgagagcgagggcagcaagccaccccactactccagc
cctgaggttgaaccagcatcctccaacaagtggcagctggataaatggctcaacaaagtc
aacccccacaagccgcccctgctgacccagagtgacgggcctgggcccgagggctcacag
tactacccggcggcggggaaggaggacgcgcaggactgcgggaagctgccagacgcgggc
ctggccgtgctgcgggacaaggacgtcaagggcgtctgcaaggaggagcagaggccgcgg
acagccaacaaggccccgggcagcaaggcagccaagcagaagtcgcctcctgccgccgtg
gcccctgccgcgcccccgccgcccgcgccaccgggggtccccaccgagagcgcgcccgcg
cccacgcgcaggtccggggccaagaagcccacgcggcgcgcggaacggagcgcggccgcc
gacgccgctatcgccacagccgccgccactgccaccgcgtgccaccggccagaggacgcc
gctgccgacacgctagggcctagcgctaccgcccccgagccccccaaggccaggccctgc
ggcgcaggcaggacgagccaccgcaaagagctgcgcgccgccccctgcgacaagcggcgc
acgcgggggatcggcaggaccgtgcccaagtccaaggagttcatcgagaccgagtcgtcc
tcgtcctcgtcctcttcctctgagtcggacctggagtcagagcaggaggagtacccgctg
tccaaggcacaggtgaccacgggctccgccacctccgccggtggcgaccagaggctgaag
gaggccagcggcgtccccgggggcacaggcccgcgggcccccgtgggctctatcaacgcc
aggaccaccagcgacatcgccaaggagctggaggagcagttctacacgctggtccccttt
ggccgcaacgaactcctctccccgctgaaggacagtgacgagatcaggtccctctgggtc
aaaatcgacctgactctcctgtctaggatcccggagcacctgccccaggagcccggggtc
ctgagtgctccagctgccaaggaccctgaggtggcagcgcccggccacgcgctggacacg
acccccgaaaaggcgctgccgaagtccaagaggaaacgcaagtgcgacaacgaagacgat
gaccgggagatgaagaaggcccagggagagaaagaaagctcttcacgactggctgcctct
gccaataatacctcgtctgcaaaccactgcaacgtgaacatcaacagcttggcaatacca
ataaataaaaatgaaaaaatgctccggtcacccatctctcccctctccgatgcgtctaaa
cacaaatattccactgaggacttaacctcttccagccgacctcatggcaatggtgtgttc
acttcctcttcttccaacaaaaagcccaaggccgacagccagctgcagtcgcatgccgga
gacctcacgaaaacagctcacagctccgaaaatggtgtcctccacaataaggcacggtca
cagacagagccctggtctccaggctccaatggccacagggactgcaagagacagaaactg
gtcttcgatgatatgcctcgcagtgcagattattttatgcaggaagctaaacgaatgaag
cataaagcagatgcaatggtggagaagtttggaaaagctttgaactatgccgaggcagcc
ttgtcatttattgagtgtgggaatgcgatggaacaaggcccgatggagtccaaatctcca
tacaccatgtactcagaaacagtggagctcatcaggtatgctatgagactaaaaacccac
tcaggccccaatgccacaccagaggacaaacagctagctgcattatgttaccgatgcctg
gctctcctgtactggcggatgttccgactgaaaagggatcacgctgtaaagtactcaaag
gcactcatcgactatttcaagaatacatccaaggctgcccaggccccgtctccttgggga
accagcggaaagagcactggaaccccatcccccatgtctcccaacccctctcccaccagc
tccgtggggtctcagggcagcctctccggtgccaatgctctgtccccatcgaccatcgtc
agcatcccacagcgcatccaccagatggcggccaaccatgtcagcatcaccaacagcatc
ctccacagttacgactactgggagatggccgacaacctagccaaggaaaacagagaattc
ttcaacgacttggatttgctcatggggcccgtcaccctgcacagcagcatggagcaccta
gtccagtactcccagcagggtctgcactggctgcggaacagcactcacctgtcatag

DBGET integrated database retrieval system