KEGG   Heterocephalus glaber (naked mole rat): 101701549Help
Entry
101701549         CDS       T02812                                 

Gene name
Gpx3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00480  Glutathione metabolism
hgl00590  Arachidonic acid metabolism
hgl01100  Metabolic pathways
hgl04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101701549 (Gpx3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101701549 (Gpx3)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    101701549 (Gpx3)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     101701549 (Gpx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 101701549
NCBI-ProteinID: XP_004836711
UniProt: A0A0P6JBW6
Position
Un
AA seq 226 aa AA seqDB search
MARLLRASCLLSLLLAGSVPWSLGQEKSKTECHGGVSGTIYEYGALTIDGEEYIPFKKYS
GKYILFVNVASYUGLTDQYLELNALQEELEPFGLVVLGFPCNQFGKQEPGENSEILPSLK
YVRPGRGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPSRLFWEPMKIHDIR
WNFEKFLVGPDGKPVMRWYHRTTVGSVKVDILAHMRRQAALLAPGK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctccttcgggcgtcctgcctcctgtccctgctcctggccggctccgtcccc
tggagcctcggacaggagaagtccaagactgagtgtcatggcggcgtgagcggcaccatc
tatgagtacggggccctcaccattgacggcgaggagtacatccccttcaagaagtacagt
ggcaaatacatcctctttgtcaacgtggccagctactgaggcctgacagaccagtacctt
gaactgaatgcactacaggaggagcttgagcccttcggcctggtggttctgggcttcccc
tgcaaccaattcggaaaacaggagccaggagagaactccgagatcctccccagcctcaag
tatgtccggccaggcagaggcttcgttcctaacttccagctctttgagaaaggggacgta
aatggggagaaagagcagaagttctacacgttcctgaagaactcctgccctcccaccgcc
gagctcctgggctcgcccagccgtctcttctgggaacccatgaagatccacgacatccgc
tggaacttcgagaagttcttggtggggcccgacggcaagcccgtcatgcgctggtaccac
cgcaccacggtgggcagcgtcaaggtggacatcctggcccacatgaggcggcaggccgcc
ctgctggccccggggaagtag

DBGET integrated database retrieval system