KEGG   Heterocephalus glaber (naked mole rat): 101701578
Entry
101701578         CDS       T02812                                 

Gene name
Rdh5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101701578 (Rdh5)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     101701578 (Rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 101701578
NCBI-ProteinID: XP_012933771
UniProt: G5BBA6
Position
Un
AA seq 318 aa
MWLPLLLGALLWAVLWLLRDRQRLPTSSPFVFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAKELQQMASSRLHTILLDITDPQSVQQAAKWVETHVQGAGLFGLVNNAGVAGIIGP
TPWLTWEDFHQVLNVNTLGPIRVTLALLPLLQQAQGRVVNITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVASFGVRVSIVEPGFFQTPVTNLESLESTLQACWARLPPALQAHYGDA
FLPAYFKVQRRLMNLICDPDLTKVSRCVEHALTARHPRNRYSPGWDAKLLWLPASYLPAS
LVDSVLAWLLPKPAQSVS
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgctgctgggtgccttgctctgggcagtgctgtggttgctcagagac
cggcagagactgcccaccagcagtcccttcgtctttatcaccggctgtgactcgggcttc
gggcgccttctggcactgcggctggaccagaggggcttccgagtcctggccagctgcctg
accccatctggggcaaaggaactacagcagatggcctcctcccgcctccacactatcctg
ctggacatcaccgatccccagagtgtccagcaggcagccaagtgggtggagacacatgtt
cagggagcagggctttttggcctggtgaataatgctggtgtggcgggcatcatcggaccc
acaccctggctgacatgggaagacttccaccaggtgctgaatgtgaataccttgggtccc
atcagggtcacccttgccctgctgcccctgctacagcaagcccagggccgagtggtcaac
atcaccagcgtcctgggtcgcctcgcagccaatggcgggggctactgtgtctccaagttt
ggcctggaggccttctcggacagtctgaggcgagacgtggcttcttttggggtacgagtc
tccatcgtggagcctggcttcttccaaacccctgtgaccaacctggagagtttggagagc
accctgcaggcctgctgggcacggctacctccagccttgcaggcccactacggggacgcc
ttcctccccgcatacttcaaagtgcagcggcgcctcatgaatcttatctgcgacccggac
ctaaccaaggtgagcagatgcgtggagcatgccctgactgctcgccacccccgaaaccgc
tacagcccaggctgggatgccaagctgctctggctgcctgcctcctacctgccagccagc
ctcgtggattccgtgctcgcctggctccttcctaagcctgcccagtcagtctcctga

DBGET integrated database retrieval system