KEGG   Heterocephalus glaber (naked mole rat): 101703263Help
Entry
101703263         CDS       T02812                                 

Gene name
Nop58
Definition
(RefSeq) NOP58 ribonucleoprotein
  KO
K14565  nucleolar protein 58
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    101703263 (Nop58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hgl03009]
    101703263 (Nop58)
Ribosome biogenesis [BR:hgl03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    101703263 (Nop58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT tRNA-synt_His
Motif
Other DBs
NCBI-GeneID: 101703263
NCBI-ProteinID: XP_004851261
Position
Un
AA seq 535 aa AA seqDB search
MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF
TALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIR
SQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYI
MRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASATLSELLPEEVEAEVKAAAEI
SMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIA
HAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISR
MLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRSLEDRGIRKISGTGKALAKAEKYE
HKSEVKTYDPSGDSTLPTCSKKRKIEHVDKEDEVIEKKAKKAKIKIKVEEEEEEEEEDEK
VLVVEEETSVKKKKKKDKKKHIKEEPVSEEEPCTSTAVPSPEKKKKKKKKKDMED
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgctgtttgagacatcggttggctacgccatctttaaggttctaaatgagaag
aaacttcaagaagttgatagtttgtggaaagaatttgaaactccagagaaagcaaataaa
atagtaaagctaaaacattttgagaaatttcaggatacagcagaagcattagcagcattc
acagctctgatggagggcaaaatcaataagcagctgaagaaggttctgaagaaaatagta
aaagaagcccatgagcctctagctgtagctgatgctaaactaggaggagtcataaaggaa
aagctgaatctcagttgtatccatagtcctgttgttaatgagcttatgaggggaatccga
tcacagatggatggattgatccctggggtagaaccacgtgaaatggcagccatgtgtctt
ggattggcccacagcctgtctcgatacagattgaagtttagcgctgataaagtggataca
atgattgttcaggcaatttccttgttagatgacttagataaagaattaaacaactacatc
atgcgttgtagagagtggtatggctggcatttcccagaattaggaaaaattatttcagat
aatttgacatactgcaagtgtttacagaaagttggtgataggaagaactatgcctccgcc
acgctttctgaattgttgccagaggaagttgaagctgaagtaaaagcagctgcagagata
tctatgggaactgaggtttctgaagaagatatttgcaatattctacatctttgcacccaa
gtgattgaaatctctgaatatagaacccagctgtatgagtatctacaaaaccgaatgatg
gccattgcacccaatgtgacagtcatggttggcgagttagttggagcacggctgattgct
catgcaggttctcttttgaatctggccaagcatgcggcttctacagttcagattcttgga
gcagaaaaggcactttttagagccctcaaatctaggcgggatacccctaaatacggtctc
atttatcatgcttcccttgtaggccagacaagtcccaaacacaaaggaaagatttctcga
atgctggcagccaaaactgttttggctattcgttatgatgctttcggggaggattccagt
tctgcaatgggagttgaaaacagagccaaattagaggccagattgagaagcttggaagat
agagggattagaaaaataagtggaacaggaaaggcattagcaaaagcagaaaaatatgaa
cacaaaagtgaagtgaaaacttacgatccctccggtgactcaacacttccaacctgttct
aaaaaacgcaaaatagaacatgtagataaagaggatgaagtgattgaaaagaaagcaaaa
aaagccaaaattaaaattaaagttgaggaggaggaggaggaggaggaggaagacgaaaaa
gtgctagtggtagaagaggagacatctgtgaagaagaaaaagaaaaaggataaaaagaaa
cacattaaggaagaaccagtttctgaggaagagccatgcaccagcacagcagttcctagc
ccggagaaaaagaagaaaaagaaaaaaaagaaagacatggaggactaa

DBGET integrated database retrieval system