KEGG   Heterocephalus glaber (naked mole rat): 101704674Help
Entry
101704674         CDS       T02812                                 

Gene name
Gss
Definition
(RefSeq) glutathione synthetase
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00270  Cysteine and methionine metabolism
hgl00480  Glutathione metabolism
hgl01100  Metabolic pathways
hgl04216  Ferroptosis
Module
hgl_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    101704674 (Gss)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101704674 (Gss)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    101704674 (Gss)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hgl04147]
    101704674 (Gss)
Enzymes [BR:hgl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     101704674 (Gss)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101704674 (Gss)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase U62_UL91
Motif
Other DBs
NCBI-GeneID: 101704674
NCBI-ProteinID: XP_004867952
Position
Un
AA seq 434 aa AA seqDB search
MATSWESLLQDEHLLEELALQAMDRALAEGVLLRTSREPSSSDVVSYAPFTLFPSLVPQA
LLEQAYAVQMDFNLLVDAVSQNSAFLEQTLSSTIKRDDFTAHLFDIYKQVLKEGIAQTVF
LGLNRSDYMFQRSADGFPALKQIEINTISASFGGLASRTPAVHRHVLSVLSRTEEAAKIL
SNNPSKGLALGIAKAWELYGSTNALVLLIAQEKERNVFDQRAIENELLARNIHVIRRRFE
DVSEKGSLDQDRRLFMDGQEVAVVYFRDGYMPSQYSVKNWEARLLLERSCAVKCPDIATQ
LAGTKKVQQELSRVGVLEALLPGQPEAVARLRATFAGLYSLDMGEEGDQAIAEALAAPSR
FVLKPQREGGGNNLYGEEMVQALVQLKDIEERASYILMEKIEPEPFGNCLLRPGSPARVV
QCISELGIFGVYVR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggccacaagctgggagagcctcttgcaagatgagcatctgctggaggagctggctctg
caggccatggaccgggccttggctgagggtgtgttgctgaggacttcgagggagcccagc
tcctcagatgtggtgagctatgcccctttcacgctcttcccctcactggtcccccaagcc
ctgctggagcaagcctatgctgtgcagatggacttcaacctgctagtggatgctgtcagc
cagaactctgccttcctggagcaaactctctccagcaccatcaaaagggatgactttact
gcccatctctttgacatctacaagcaagtcttgaaagagggcattgctcagactgtgttc
ctgggcctgaaccgctcagactacatgttccagcgcagtgcggatggcttcccagctctg
aaacagattgaaatcaacactatttctgccagttttgggggccttgcctcccggactcca
gctgtacatcgacatgttctcagtgtcctgagtaggacagaagaagctgccaagatcctc
tccaataatcccagcaagggactggccttgggaattgccaaagcctgggagctgtatggc
tcaaccaatgctctggtgctactgattgctcaagagaaggaaaggaacgtatttgaccag
cgtgccatagaaaacgagctactggccagaaacatccatgtaatccggcgaagatttgaa
gatgtgtctgagaaggggtctctggaccaagacaggaggctgtttatggatggccaggaa
gttgctgtggtttacttcagggatggctacatgcccagtcagtacagtgtaaagaactgg
gaagcacgcctactgctggagaggtcatgtgctgtcaagtgcccagacattgccacccag
ctggctgggactaagaaggtgcagcaggagctgagcagggtgggcgtgctggaggcgctg
ctccctggccagcccgaggctgtggccagactccgtgccacttttgctggcctctactca
ctggacatgggtgaagaaggggaccaggccattgctgaggcccttgctgctccaagccgg
tttgtgctaaagccccagagagagggtggaggtaacaacctgtatggggaggaaatggta
caggccctcgtgcagctgaaggacatcgaggagagggcctcctacatcctcatggagaag
attgaacctgagccttttgggaattgcctgctccggcctggcagccctgccagagtggtc
cagtgcatctcagagctgggtatcttcggagtctatgtcaggtaa

DBGET integrated database retrieval system