KEGG   Heterocephalus glaber (naked mole rat): 101705849Help
Entry
101705849         CDS       T02812                                 

Gene name
Pla2g4e
Definition
(RefSeq) phospholipase A2 group IVE
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00564  Glycerophospholipid metabolism
hgl00565  Ether lipid metabolism
hgl00590  Arachidonic acid metabolism
hgl00591  Linoleic acid metabolism
hgl00592  alpha-Linolenic acid metabolism
hgl01100  Metabolic pathways
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04217  Necroptosis
hgl04270  Vascular smooth muscle contraction
hgl04370  VEGF signaling pathway
hgl04611  Platelet activation
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04724  Glutamatergic synapse
hgl04726  Serotonergic synapse
hgl04730  Long-term depression
hgl04750  Inflammatory mediator regulation of TRP channels
hgl04912  GnRH signaling pathway
hgl04913  Ovarian steroidogenesis
hgl04921  Oxytocin signaling pathway
hgl05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101705849 (Pla2g4e)
   00565 Ether lipid metabolism
    101705849 (Pla2g4e)
   00590 Arachidonic acid metabolism
    101705849 (Pla2g4e)
   00591 Linoleic acid metabolism
    101705849 (Pla2g4e)
   00592 alpha-Linolenic acid metabolism
    101705849 (Pla2g4e)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101705849 (Pla2g4e)
   04010 MAPK signaling pathway
    101705849 (Pla2g4e)
   04370 VEGF signaling pathway
    101705849 (Pla2g4e)
   04072 Phospholipase D signaling pathway
    101705849 (Pla2g4e)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101705849 (Pla2g4e)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101705849 (Pla2g4e)
   04664 Fc epsilon RI signaling pathway
    101705849 (Pla2g4e)
   04666 Fc gamma R-mediated phagocytosis
    101705849 (Pla2g4e)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101705849 (Pla2g4e)
   04913 Ovarian steroidogenesis
    101705849 (Pla2g4e)
   04921 Oxytocin signaling pathway
    101705849 (Pla2g4e)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101705849 (Pla2g4e)
  09156 Nervous system
   04724 Glutamatergic synapse
    101705849 (Pla2g4e)
   04726 Serotonergic synapse
    101705849 (Pla2g4e)
   04730 Long-term depression
    101705849 (Pla2g4e)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101705849 (Pla2g4e)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101705849 (Pla2g4e)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101705849 (Pla2g4e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2 ICAT
Motif
Other DBs
NCBI-GeneID: 101705849
NCBI-ProteinID: XP_012933904
Position
Un
AA seq 861 aa AA seqDB search
MDEAGMDPLVLGSQCDLGTDALLPWSPQRYEEDSKWGDTQDLEALPRPPVLPVAPCTSQE
GQSPCHLLTVRVIQMKNVRQADLLSQTDCFVSLWLPTASSEKVRTRTISNCPNPEWNETF
SFQIQTQVKNVLELSVCDEDPITPNDHLLIVLYDLSKLCFRKKVHVKFPLNPEGLEELEV
EFLLAESPSPAETLITNGVLVSRQVSCLEVHAESRRQRKRKKMKDLLVTVTESFENTQRI
SPRREPCCPDPSSFHYPKYFQPCLQVAVPKSHWDCLLSCCSTHKSSPVCQPLDCLSDSQA
VTLPVNENYELHMKSTPCPDTLDVRLGFNLCPEELKFLEKRKVVVAEALKQVLQLEEDLA
EDEVPLIAIMATGGGARSMTSLYGHLLGLQKLNLLNCSSYISGLSGATWTMATLYQDPEW
SSKDLQSAIFEARRHAVKDKMPSLFPDQLLKFKEELRQRTQEGYKVTFTDFWGLLLESCL
GDESSEYKLSDQRAAVCQGQNPLPIYLTINVKDDVSNQDFREWCEFSPYEVGMQKYGAFI
PPELFGSEFFMGRLMKRIPESRMCYMLGLWSSIFSLNLLDAWNLCNTSEEFLHRWTREKV
HDIEDEPLLPEIPKCDANILETSVVNPASWLSNTFREVLTYRSFGSEFHNFMYGLQLHTG
YLRNSHFQKWKDTVLDRFPNQLTEFAKHLCLLDTAFFVNSSYAPLLRQERKADLVIHLNY
SAGSQTKPMKQTCEYCTEQGIPFPSYGIEDDDQNLQECYLMEQPQDPDVPVVAFFPLIND
TFQKYKAPGVERSPEEMELGQVNIYGPKSPYATKELTYTEAAFDKLVKLSEYNILNNKDK
LLQALRLAVEKKKRLRSPCPS
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggctggaatggacccgctggtcttgggaagccaatgtgacctgggaactgat
gcacttcttccttggagcccccaaaggtatgaagaagacagcaagtggggagacacacag
gacctggaggctctccctcgcccacctgtgcttcccgtggccccttgcacctctcaggag
ggccagtctccatgccacctgctgacagtgagggtcatccagatgaaaaatgtccgccag
gctgatctattgagccaaacagactgctttgtgagcctctggctgcccactgcctcttct
gagaaggtgaggaccaggaccatctccaactgcccaaacccagagtggaacgaaaccttc
agcttccagatccagacccaagtgaagaacgtgctagagctgagcgtttgtgatgaagac
ccaataacacccaacgaccatctcttgatagttctctatgacctctccaagctctgcttc
cggaagaaagtccatgtgaagttcccactcaacccagagggcttggaggagctggaggtg
gagttcttgctggcagagagtccctctccggcggagaccctcatcaccaatggcgtgctg
gtgtctcgccaagtctcttgcctagaggttcacgcagaatccaggcggcagaggaagagg
aagaaaatgaaagacctgttggtgacagtgactgaatccttcgagaacacccagcgcatc
tcaccccgcagggagccctgctgccctgacccttcctccttccactaccccaagtacttt
cagccctgcttgcaggtggctgtgcccaagagccactgggactgtttgctcagctgctgc
agtacacataagagcagtcctgtctgccagcccctcgactgcctttctgacagccaagcc
gtgaccctgcctgtgaatgagaattatgaactacacatgaagtccacaccctgccctgac
acactagatgtacgactgggcttcaacctatgccccgaggagctcaaatttctggagaag
cggaaggtggtggtggctgaggcactgaagcaggtgctgcagctggaggaggacctggct
gaggacgaggtacctctgatagccatcatggccaccgggggtggagcaaggtccatgacc
tccctgtacggccacctgctgggactgcagaagctgaacctcctgaactgcagcagttac
atctccggcctgtctggggccacctggacgatggctactttgtaccaagatccggagtgg
tcctccaaagacctgcagtctgctatctttgaggcccggagacatgccgtcaaagacaag
atgccctccctattcccagaccagctcctcaaattcaaggaggaactccggcagcgcacc
caggaaggctacaaggtcacctttacagacttctggggcctgctgcttgagtcctgtctg
ggggatgagagtagtgagtacaaactatcagaccagcgtgctgctgtgtgccagggccag
aaccccctgcccatctacctcaccatcaatgtcaaggatgatgtaagcaaccaggacttc
agagagtggtgtgagttctccccctacgaagtggggatgcagaagtacggggccttcatc
ccacccgaactcttcggctctgagttcttcatgggacggctgatgaagaggatccccgag
tcacggatgtgctacatgctaggtttgtggagcagcatcttctccctgaacctactcgac
gcctggaatctgtgcaacacctcagaggagtttttgcaccgatggacgagggagaaagta
catgacatcgaagacgagccactcttgcctgaaatccccaaatgtgatgctaacatcctg
gagacctcggtagtgaacccagcatcctggctgtccaatactttccgagaagtcctcacc
taccggtccttcgggtctgagttccacaacttcatgtacgggctgcagctacacactggg
tatctccgcaacagccacttccagaagtggaaagacacagtgctggaccgctttccaaac
cagctgacagagtttgccaaacacttgtgcctgctggacacggcattcttcgtcaactcc
agctatgcacccctcctcaggcaagagagaaaagctgacctcgtcatccacctcaattac
tccgctgggtcccagacgaagcccatgaaacagacctgcgagtactgcactgagcagggg
atccccttccccagctatggcatcgaggatgatgatcaaaacctccaggagtgctacctg
atggagcagccccaggaccccgatgtgcccgtcgtggctttcttcccgctcatcaacgac
accttccagaagtacaaggcaccgggcgtggagcggagccccgaggagatggagctgggc
caagttaacatttatggccccaaatctccctatgccaccaaggagctgacatacacggaa
gctgcctttgacaagctggtgaagctctcagagtacaacatcctgaataacaaagacaag
ctcctccaggccctgcgcctggcagtggagaagaagaaacgcctgaggagcccatgtcct
tcctag

DBGET integrated database retrieval system