KEGG   Heterocephalus glaber (naked mole rat): 101706066Help
Entry
101706066         CDS       T02812                                 

Gene name
Aspg
Definition
(RefSeq) asparaginase
  KO
K13278  60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101706066 (Aspg)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     101706066 (Aspg)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     101706066 (Aspg)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     101706066 (Aspg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asparaginase Asparaginase_C Ank_4 Ank_2 Ank Ank_3 Ank_5 Rubella_E1
Motif
Other DBs
NCBI-GeneID: 101706066
NCBI-ProteinID: XP_004836927
Position
Un
AA seq 590 aa AA seqDB search
MCKSRVCDPFMTRELGTAGSGKGLQASQELPNQKGSGAGGDRPAAGAGGRVLVPSRDLAA
VLRTLPMFHDEAHARAWGLPDDTLVLPPACPDQRVIYTVLERQPLLDSSDMTITEWVQVA
QIVERHYEQYHGFVVIHGTDTMAFAASVLSFVLENLHKPVILTGAQVPIHALWNDGRENL
LGALLMAGQYIIPEVCLFFQNQLFRGNRATKVDTQRFGAFCSPNLPPLATVGTDVTVSWE
LVRKVSREDQLVVHSSVEHNVGLLRLYPGIPASLVRAFLQPPLKGVVLETFGSGNGPTKP
DLLQELRAAAERGLILVNCTHCLQGAVTPGYAAGLASVGAGIVSGFDMTSEAALAKLSYV
LGRPGLSLDDRKQLLAKDLRGEMTLPTVDKHQSPLQGSKLGHSVAWLLGLSGSQEADAVR
DTLVPSLALAAAHAGDLEALQALVELGSGLCLQDPNGQTLLHAAARRGHVGAVTMLLRRG
VDVSARDQDGLTPLLLAVRGRHWGVIQLLRAAGACLSPQDLEDAGTELCRLASRADTEGL
RAWCQAGADLEQPGYDGRSALRVAEAAGNLEVVALLQSLEGAGHEALPGV
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaatccagagtctgtgacccattcatgacccgggaactgggtacagctggcagc
ggcaaagggctgcaggccagccaggagctgccaaaccagaagggcagtggtgccggtggg
gacaggcctgcagcaggagctggggggagagtgctggtccccagccgagacctggctgcc
gtgctgcgaacgctgcccatgttccatgacgaggcgcatgcccgggcctggggcctcccc
gatgacaccctggtgctgccccccgcctgccctgaccagagggtcatctacacagtgctg
gagcgccagcccctcctggactccagcgacatgaccatcacggagtgggttcaggttgcc
cagatcgtggagagacactacgagcagtaccacggctttgtggtcatccacggcaccgac
acgatggccttcgccgcctccgtgctgtccttcgtgctggaaaacctgcacaaacctgtc
atcctcactggtgcccaggtgcccatccacgcgctgtggaacgacggccgggagaacctg
ctgggggcgctgctcatggccggccagtacattatccccgaggtctgcctgttcttccag
aatcagctgtttcggggcaaccgggcaaccaaggtggacacccagaggtttggggccttc
tgctcccccaacctgcccccgctggccactgtgggcacagacgtcacagtctcctgggag
ctggtgcggaaggtcagccgggaggaccagctggtggtgcacagcagcgtggagcacaac
gtggggctactgcgcctctaccctggcatccccgcctccctggttcgggccttcctgcag
ccccctctcaagggtgtggtcttggagaccttcggttctggcaatgggcccaccaagcct
gacctgctgcaggagctgcgggcagcggccgagcgcggcctgatccttgtcaactgcacc
cactgccttcagggggccgtgaccccgggctatgcagcgggcttggcttcagtgggcgcc
ggcatcgtctcaggcttcgacatgacgtcagaggccgccctggccaagctgtcctatgtc
ctgggccggccggggttgagcctggatgacaggaagcagctgctggccaaggatcttcgc
ggggagatgacgttgcccaccgtggacaagcaccagtcccctctgcagggcagcaagctg
ggtcacagtgttgcctggcttctgggtctgagtggcagccaggaggcagatgccgtgcgg
gacaccctggtgcccagcctcgccctggctgcagcccacgcaggtgacctggaggctctg
caggcgcttgtggagctgggcagtggcctgtgcctgcaggaccctaacggccaaaccctg
ttgcatgcggccgcgcggaggggccacgtgggggcagtaaccatgctgctgcgcaggggc
gtggatgtgagcgcccgcgaccaggacggcctcaccccgctgctgctggctgtgcggggc
aggcactggggcgtcatccagctgctgcgggcagccggggcctgcctgtccccccaggac
ctggaggacgcagggacagagctgtgcaggctggcatccagggcggatacagaaggcctg
cgggcatggtgccaggccggggctgacctggagcagccgggctacgacgggcgcagtgct
ctgcgtgtcgcggaagccgcagggaacctggaggtggtggccctgctacagagcctggag
ggtgcaggccatgaagcgctgcctggtgtctaa

DBGET integrated database retrieval system