KEGG   Heterocephalus glaber (naked mole rat): 101706305Help
Entry
101706305         CDS       T02812                                 

Gene name
Hspa2
Definition
(RefSeq) heat shock protein family A (Hsp70) member 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl03040  Spliceosome
hgl04010  MAPK signaling pathway
hgl04141  Protein processing in endoplasmic reticulum
hgl04144  Endocytosis
hgl04213  Longevity regulating pathway - multiple species
hgl04612  Antigen processing and presentation
hgl04915  Estrogen signaling pathway
hgl05134  Legionellosis
hgl05145  Toxoplasmosis
hgl05162  Measles
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101706305 (Hspa2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101706305 (Hspa2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101706305 (Hspa2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101706305 (Hspa2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101706305 (Hspa2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101706305 (Hspa2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101706305 (Hspa2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101706305 (Hspa2)
  09172 Infectious disease: viral
   05162 Measles
    101706305 (Hspa2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101706305 (Hspa2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hgl01009]
    101706305 (Hspa2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hgl03041]
    101706305 (Hspa2)
   03009 Ribosome biogenesis [BR:hgl03009]
    101706305 (Hspa2)
   03110 Chaperones and folding catalysts [BR:hgl03110]
    101706305 (Hspa2)
   04131 Membrane trafficking [BR:hgl04131]
    101706305 (Hspa2)
   03051 Proteasome [BR:hgl03051]
    101706305 (Hspa2)
   03029 Mitochondrial biogenesis [BR:hgl03029]
    101706305 (Hspa2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hgl04147]
    101706305 (Hspa2)
Protein phosphatases and associated proteins [BR:hgl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101706305 (Hspa2)
Spliceosome [BR:hgl03041]
 Complex B
  Other components
   Prp19 complex
    101706305 (Hspa2)
 Complex C
   Prp19-CDC5 complex
    101706305 (Hspa2)
Ribosome biogenesis [BR:hgl03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    101706305 (Hspa2)
Chaperones and folding catalysts [BR:hgl03110]
 Heat shock proteins
  HSP70 / DNAK
   101706305 (Hspa2)
Membrane trafficking [BR:hgl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    101706305 (Hspa2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101706305 (Hspa2)
Proteasome [BR:hgl03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101706305 (Hspa2)
Mitochondrial biogenesis [BR:hgl03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    101706305 (Hspa2)
Exosome [BR:hgl04147]
 Exosomal proteins
  Proteins found in most exosomes
   101706305 (Hspa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C CRIC_ras_sig Hydantoinase_A Zincin_2
Motif
Other DBs
NCBI-GeneID: 101706305
NCBI-ProteinID: XP_004837467
Position
Un
AA seq 638 aa AA seqDB search
MCSRGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI
SSMVLTKMKEIAEAYLGAKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGRAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIAPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNAVESYTYSIKQTVEDEKLRGKISEQDKSKILSKCQEVISWLDRNQMAEKDEYEHKQK
ELERVCNPIITKLYQGGPGGGGGGGAGASGGPTIEEVD
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcccgcggcccggccatcggcatcgatctggggaccacctactcctgcgtgggg
gtcttccaacatggcaaggtggagatcatcgccaatgaccagggcaaccgaaccaccccc
agttacgtggccttcacagacaccgagcgcctcatcggcgacgcggccaagaaccaagtg
gccatgaaccccaccaacaccatcttcgacgccaagaggctgatcgggcggaagtttgag
gacgccacagtgcagtcggatatgaaacactggccgttccgggtggtgagcgagggaggg
aagcccaaagtgcaggtggagtacaagggggagacgaagaccttcttcccggaggagatc
tcctccatggtgctcacgaagatgaaggagatcgctgaggcctacctgggggccaaggtg
cagagcgcggtcatcacggtccccgcctatttcaacgactcgcagcgtcaggccaccaag
gacgcgggcaccatcaccggcctcaacgtgctgcggatcatcaatgagcccacggcggcg
gccatcgcctacggcctggacaagaagggccgcgcgggcggcgagaagaacgtgctcatc
ttcgacctgggcggcggcaccttcgacgtgtccatcctgaccatcgaggacggcatcttc
gaggtgaagtccacagccggcgacacccacctgggcggcgaggatttcgataaccgtatg
gtcagccacctggccgaggagttcaagcgcaagcacaagaaagatatcgcgcccaacaag
cgcgcggtgcggcggctgcgcacggcctgcgagcgggccaagcgcaccctgagctcatcc
acccaggccagcatcgagatcgattccctctacgagggcgtggacttctacacgtccatc
acccgcgcccgcttcgaggagctcaacgcagacctcttccgcgggaccctggagccggtg
gagaaggcgctgcgcgacgccaagctggacaagggccagatccaggagatcgtgctggtg
ggcggctccacccgcatccccaagatccagaagctgctgcaggatttcttcaacggcaag
gagctgaacaagagcatcaaccccgacgaggcggtggcctacggcgccgcagtgcaggcg
gccatcctcatcggggacaagtcggagaacgtgcaggatctgctactgctcgacgtgacc
ccgctgtcgctggggatcgagacggccggcggcgtcatgaccccgctcatcaagaggaac
accacgatccccaccaagcagacgcagaccttcaccacctactcggacaaccagagcagc
gtgctggttcaggtgtacgagggcgagcgggccatgactaaggacaacaacctgctgggc
cgcttcgagctcagcggcatccccccggcgccccgcggcgtgccccagatcgaggtgacc
ttcgacatcgacgccaacggcatcctcaacgtcactgccgccgacaagagcaccggtaaa
gaaaacaagatcaccatcaccaacgacaagggtcgtctgagcaaggacgacattgatcgg
atggtgcaggaggcggagcgctacaagtcggaagatgaggccaatcgcgaccgcgtcgca
gccaaaaacgcagtggagtcgtatacatacagcatcaagcagacagtagaagacgagaaa
ctgaggggcaagattagcgagcaggacaagagcaagatcctcagcaagtgtcaggaagtg
atcagctggctcgatcggaaccagatggcagagaaagacgagtacgaacacaagcagaaa
gagctggaaagagtgtgcaaccccatcatcaccaagctttaccaaggcggtcctggcggc
ggcggcggcgggggggctggagcctccgggggacccaccatcgaagaagtggactga

DBGET integrated database retrieval system