KEGG   Heterocephalus glaber (naked mole rat): 101706813
Entry
101706813         CDS       T02812                                 

Gene name
Erap1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hgl01002]
    101706813 (Erap1)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     101706813 (Erap1)
Peptidases and inhibitors [BR:hgl01002]
 Metallo peptidases
  Family M1
   101706813 (Erap1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 101706813
NCBI-ProteinID: XP_004841773
Position
Un
AA seq 942 aa
MVPQPLKWPFASMSFLLSSLLTLLAVSTPSRCQSSDTISPKASNGSSFPWNKMRLPEYVI
PAHYDLTIHANLSTLAFWGTTEIEITASQPTSAIILHSHNLQISKATLRKEAGQGPSEEP
LRVLEYPRHEQIALLALEPFLVGLPYTVVIHYAGNLSETFHGFYKSTYRTKQGEVRVLAS
TQFEPVAARMAFPCFDEPAFKASFSIKVRREPRHMAISNMPLVKSVTIAEGLIEDHVDVT
VKMSTYLVAFIISDFKSVSKMTKSGVKVSVYAMPDKIKQADYALDAAVTLLEFYEDYFSI
PYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDPEKSSASSKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFSAMEFDALNSSHPV
STPVENPAQIREMFDDVSYEKGACILNMLREYLSADVFKSGIVQYLQKYSYKNTKNEDLW
NTMASICPGDGTQTTDGFCSQSQHSSSSSHWRQEGVDVKAMMNTWTLQKGFPLITITVKG
RNVHMEQEHYMKGSDGAPETGYLWHVPLTFTTSKSDSVQRFLLKTKTDVLILPEAVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLKKTHTVISSNDRASLINSAFQLVSIGKLSIEKALD
LTLYLKHETEILPVFQGLNELIPMYKLMEKRDMTEVETQFKTFLIQLLRDLIDRQTWTDD
GSVSEQMLRSQLLLLACVLKYQPCVQRAEGYFRKWKESNGNMSLPIDVTLAVFAVGAQNT
DGWDFLFSKYHSSLSSTEKSQIEFALCVSQNEEKLQWLLDQSFKGDIIKTQEFPHILTLI
GRNPVGYPLAWQFLKENWNKLVQKFELGSSSIAHMVMGTTNQFSTKTRLAEVKGFFHSLK
ENGSQLRCVQQTIETIEENIHWMDKNFDKIRVWLQHGKPELL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atggtacctcagcccctcaagtggccatttgcaagcatgtcatttctactttcttcactg
ttgactctcttagctgtgtcaactccttcacggtgtcagagcagtgacactatatctcca
aaagctagcaacggatcttcatttccttggaacaaaatgagacttccggagtatgtcatc
ccagctcattatgatctcacgatccatgcaaacctcagcacgttggctttctggggcacc
acagaaatagaaatcacagccagccagcccaccagtgccattatcttgcatagccacaac
ctacagatctccaaggccaccctcaggaaagaagcaggtcaggggccatctgaagaacca
ctgagggtcctggaatacccccgtcatgaacaaattgctcttttagctctggaacccttc
ctcgttgggctcccgtacacagttgtcatccactacgctggcaatctctccgagactttc
catggattctataaaagcacctacagaaccaagcagggggaagtaagggtactcgcatcc
acgcagtttgaaccagttgcagccagaatggcctttccctgctttgatgaaccagccttc
aaagcgagtttctccatcaaggtcagaagggagccgaggcacatggccatttccaacatg
ccgttggtgaaatctgtgactattgctgaaggactcatagaagaccacgtcgatgtcact
gtgaagatgagcacctacctggtggccttcattatttcagatttcaagtctgtcagcaag
atgaccaaaagtggagtcaaggtctctgtgtatgccatgccagataagataaagcaagca
gattatgccctggatgctgctgtgactcttctagagttttatgaagattatttcagtata
ccatatcctttacccaaacaagaccttgctgctattcctgactttcagtctggtgccatg
gaaaactggggcctgacaacatacagagaatctgctttgttgtttgatccagaaaagtct
tctgcatccagtaagcttggcatcacaatgactgtatcccacgaacttgctcaccagtgg
tttgggaacctggtcactatggaatggtggaatgatctttggctaaatgaaggatttgct
aagtttatggagttcgtgtctgtcagtgtgacccatcctgaactgaaagttgaagattat
ttctttggcaagtgttttagtgcgatggagtttgatgccttaaattcctcacaccctgtg
tccacacctgtggagaatcctgctcagattcgggagatgtttgatgatgtttcttacgaa
aagggtgcttgtattctgaatatgctgagggagtatcttagtgctgatgtatttaaaagt
ggaattgtgcagtatctccaaaagtactcttataaaaatacaaaaaatgaggacctgtgg
aatacgatggccagcatttgcccgggagatggtacacaaaccacggatggcttctgttcc
caaagccagcattcatcttcctcctctcactggcgtcaggaaggtgtggatgtgaaggcc
atgatgaacacctggacgctgcagaagggctttcccctgataaccatcacagtgaaaggg
aggaacgtgcacatggagcaggaacactacatgaaggggtctgatggtgccccagaaact
gggtacttatggcacgttccattgacattcactaccagcaaatcagactcagtccagaga
tttttgctgaagactaagacagatgtgctcatcctcccagaagcagtggagtggatcaaa
tttaatgtgggaatgaatggctattacatcgtgcattacgaggatgatggatgggattct
ttgactgggctcttaaaaaagacacacacagtgatcagcagtaacgatcgagcgagtctc
attaacagtgcatttcagcttgtcagcattggaaagctatcgattgaaaaagccttggat
ttaaccctgtacttgaaacatgaaactgaaatcctgcctgtgttccaagggttgaatgag
ctgatccctatgtataagttaatggagaaaagagatatgactgaagtggaaactcaattc
aagaccttcctcatccagctgctgcgggacctcattgataggcagacctggacagatgat
ggctccgtctcagagcagatgcttcggagtcagctcctcctgctggcctgtgtgctcaag
tatcagccctgtgtgcagagggcagaaggctatttcagaaagtggaaggaatccaatgga
aacatgagcctgcctattgatgtgaccctggcagtgtttgctgtgggggcccagaacact
gatggatgggattttctttttagtaaatatcactcttctttatcgagtaccgagaaaagc
caaattgaatttgccctctgtgtaagccaaaatgaggaaaagcttcagtggttactagat
caaagttttaagggagatataataaaaactcaagagtttccacatattctcacactcatt
ggcagaaacccagtgggatatccattggcctggcagtttctgaaggaaaactggaataaa
cttgtacaaaagtttgaacttggatcatcttccatagcccacatggtaatgggaacaaca
aatcaattctctaccaaaacacgacttgcagaggtaaaaggattcttccactctttgaaa
gaaaatggctctcagctccgttgtgtccaacaaactattgaaaccatcgaggaaaacata
cattggatggataaaaattttgataaaatcagagtgtggctgcaacatggaaagcctgaa
ctgctgtaa

DBGET integrated database retrieval system