KEGG   Heterocephalus glaber (naked mole rat): 101707046
Entry
101707046         CDS       T02812                                 

Gene name
Akap5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hgl01009]
    101707046 (Akap5)
Protein phosphatases and associated proteins [BR:hgl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     101707046 (Akap5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 101707046
NCBI-ProteinID: XP_004837469
UniProt: G5BD01
Position
Un
AA seq 431 aa
MEATVSEIQVENKDEKRSAEVSPQDKKQKEKTSILCFKRRKKAAKVLQPRAGSEAAGVAR
KHPLQEGASDQPQQPGSTWASIKGLVSRRKRSDSSKQQKPPEAEVQSEIKAGNDDLSKKK
AKSRLKISCIKFSRGTQKSNQSKIIEDSDCSMKAQGEAKALDIQTGTQSDDQAMKAQSTQ
DPCEEGIPQKDGEELCESNVSTSITSGENVISVELELDNGHSALQTGTLLLEKEIEMMEE
KPSVQSQQASLPGSSETDNQQPVASDASPSPALPDRQTVEKSSNSTPESEPSWKVYESRE
TVVEEENEPKDTELSQKSDLKENKINVEKPKSEESKRMEPIAIIITDTEVSEFDVKKSKN
VPKQFFISIENEQVGFFANDSDFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMAS
DDNQINTSTVT
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggaggccacagtttctgaaattcaagtagaaaataaagatgagaagagatctgcagaa
gttagcccacaggacaagaaacagaaggagaaaacatccatactttgcttcaagagaaga
aagaaagcagccaaggtgctgcagcccagagctggctctgaggctgctggggtggcccgg
aagcatcccctacaagaaggggcttctgaccagccacagcaaccagggagtacctgggcc
tcaatcaaaggcctggtgtcacgcaggaaaaggtcagactcttcaaagcagcaaaagcca
cctgaggctgaagtacaatctgaaataaaggctggaaatgatgatctttctaagaaaaag
gctaaatccagacttaagatttcctgcataaaattctcaagagggacacaaaagagtaat
cagtccaaaattatagaagactcagactgcagtatgaaagcccagggtgaggcaaaagct
ttggatatacaaactggaacccaatctgatgaccaggcaatgaaggctcagtcaacccaa
gatccatgtgaagaaggcattccacaaaaagacggggaggagctctgtgagtcaaatgtg
agcaccagcataacatctggagagaatgtgatttcagttgaactggagctagataatggg
cattctgctcttcaaacaggaactctactccttgaaaaggaaattgaaatgatggaggag
aagccaagtgttcaatcccagcaagcaagcctacctggaagttcagaaacagacaatcag
caaccagtggcttctgatgccagtccttcacccgcattaccggatcggcaaactgtggaa
aaatccagtaacagcaccccagaaagtgaaccaagttggaaagtctatgaaagtagagag
actgtagttgaagaagagaatgagccaaaagatactgaattgagccagaaatcagacttg
aaagaaaataagatcaatgtagagaaacccaaatcagaagaaagcaaaagaatggagcca
attgccattattattacagacacagaagtcagtgaatttgatgttaaaaaatctaaaaat
gtccctaaacaattctttatttcaattgaaaatgaacaagtagggttttttgctaatgac
agtgattttgagggtagaacttcagaacagtatgaaacactcttaatagaaacagcttct
tctctcgtcaagaatgctatccagttatctatagaacagctggttaatgaaatggcctct
gatgataatcaaataaatacttctacagtgacttaa

DBGET integrated database retrieval system