KEGG   Heterocephalus glaber (naked mole rat): 101707987Help
Entry
101707987         CDS       T02812                                 

Gene name
Mgll
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00561  Glycerolipid metabolism
hgl01100  Metabolic pathways
hgl04714  Thermogenesis
hgl04723  Retrograde endocannabinoid signaling
hgl04923  Regulation of lipolysis in adipocytes
Module
hgl_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    101707987 (Mgll)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    101707987 (Mgll)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101707987 (Mgll)
  09159 Environmental adaptation
   04714 Thermogenesis
    101707987 (Mgll)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hgl01002]
    101707987 (Mgll)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101707987 (Mgll)
Peptidases [BR:hgl01002]
 Serine Peptidases
  Family S33
   101707987 (Mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 DLH Abhydrolase_3 PGAP1 Abhydrolase_5 Thioesterase DUF1350 DUF2974
Motif
Other DBs
NCBI-GeneID: 101707987
NCBI-ProteinID: XP_004875335
UniProt: A0A0P6JIX7
Position
Un
AA seq 313 aa AA seqDB search
MEAGVEDPSRMPEEGSPRQRLQNNPVPDFPHLLNADGQYLFCQYWKPSRPPKALVFVSHG
AGEHCGRYDDLARMLMELDLLAFAHDHVGHGRSDGERLVVSDFQIFVRDVLHHVDTMQKD
YPGLPVFLLGHSMGGAIAILAAAERPGHFAGMALIAPLVLPSPESATTFKVLAAKVLNLV
LPNLSLGAVDFNILSRNREEVENYNSDPLVYHGGLKVSFCTQLLNAVSRVERGMPKLTLP
FLLLQGSDDHLCDNKGAYLLMDGAKSQDKTLKVYEGAYHMLHKELPEVTNSVFHEINMWF
SQRTAETGARCPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaggagttgaagacccttccaggatgccggaggaaggttctccgcggcagcgg
ctgcagaacaatcctgtcccagactttcctcacctgctcaatgctgatgggcagtacctc
ttctgccagtactggaagcccagcaggcctcccaaggccctggtcttcgtgtcgcacggt
gcgggggagcactgtggccgctatgatgacctggctcgcatgctgatggagctagacctg
ctggcttttgcccacgaccacgttggccatggtcggagtgatggggagaggttggtggtg
tctgacttccagatctttgtcagggacgtgctgcatcatgtggacaccatgcagaaggac
tatcccggcctgccagtcttcctgctgggccactctatgggcggagccatcgccatcctc
gcagctgccgagaggcccggccacttcgccggcatggccctcattgcacctctggtcctc
cccagtccagaatctgcaaccactttcaaggtcctcgctgcgaaagtgctcaacctggtc
ctgcccaacctgtccctgggcgcagtcgacttcaacatactgtctcggaacagggaggag
gttgagaattacaactcggaccctcttgtctaccatggagggttgaaagtgtccttttgc
acccagctgctgaatgccgtgtcgagggtggagcgggggatgcccaagctgaccctgccc
ttcctgctgctccagggctccgatgaccacctgtgtgacaacaaaggggcctacttgctc
atggatggggccaagagccaggacaagacactcaaggtttacgaaggcgcctaccacatg
cttcacaaggagctgcccgaagtgaccaattccgtcttccatgagataaacatgtggttc
tctcaaaggacagctgaaacaggagccaggtgcccgccctga

DBGET integrated database retrieval system