KEGG   Heterocephalus glaber (naked mole rat): 101708612Help
Entry
101708612         CDS       T02812                                 

Gene name
Mapkapk2
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04218  Cellular senescence
hgl04370  VEGF signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04722  Neurotrophin signaling pathway
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101708612 (Mapkapk2)
   04370 VEGF signaling pathway
    101708612 (Mapkapk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101708612 (Mapkapk2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101708612 (Mapkapk2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101708612 (Mapkapk2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101708612 (Mapkapk2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101708612 (Mapkapk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101708612 (Mapkapk2)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101708612 (Mapkapk2)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   101708612 (Mapkapk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 101708612
NCBI-ProteinID: XP_012934021
Position
Un
AA seq 493 aa AA seqDB search
MIEGKCSPEETLRQEPELEEKLPAQIRPCHLGAQSCCCRAVRLRHTSHHRRAVQGGKAQA
PLRPAPDADEPVTRPPAPGLLLRRAAASPRPARVARSPERQAPGGRAGSCAPGPPPPPPP
QPPAPAAHPPAPPPQFPQFHVKSGLQVKKNAIIDDYKVTSQVLGLGINGKVLQIFSKRTQ
EKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELF
SRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTD
FGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNH
GLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQ
STKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRR
KKARALEASALAH
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaggaaagtgttcccccgaggagacactgaggcaggagccggagctggaggag
aagctgcctgcacagattcggccatgccatctcggggcccagagctgctgctgccgtgcg
gtgcggcttaggcacaccagccaccaccgcagggctgtgcagggcggcaaggcacaggca
ccactcagaccggccccggacgcagacgagcctgtgacgcggccgccggccccggggctg
cttcttcgtcgcgcggccgcttccccccggccggcccgcgtcgcgcgttccccggagcgc
caggcccccggggggagagccgggtcgtgcgccccggggccgccgccgccgccgccgccg
cagccccccgccccggccgcgcaccccccggccccgccgccgcagttcccgcagttccac
gtcaagtcgggcctgcaggtcaagaagaacgccatcatcgacgactacaaggtcaccagc
caggtcctggggctcggcatcaacggcaaagttttgcagatcttcagcaagcggacgcag
gagaaattcgcgctgaaaatgctgcaggactgcccaaaggcccgcagggaagtggagctg
cactggcgggcctcccagtgccctcacattgtgcgcatcgtggacgtctacgagaacctg
tatgcggggaggaagtgcttgctgattgtcatggagtgtttggatggtggagagctcttc
agccgaatccaggaccgaggagaccaggcattcacagaaagagaagcatcagagatcatg
aagagcatcggcgaggccatccagtatttgcactcaatcaacattgcccaccgggacgtc
aagccagagaatctcttatacacctccaaaaggcccaacgctattctgaagctcactgat
tttggctttgccaaggaaaccaccagccacaactctctgaccactccttgttacacacca
tactatgtggctccggaagtgctgggcccagagaagtatgacaagtcctgcgacatgtgg
tccttgggtgtcatcatgtacatcctgctgtgtgggtatcctcccttttattccaaccat
ggccttgccatctctccgggcatgaagacccgcatccgaatgggccaatatgaatttccc
aacccagagtggtcagaagtatcagaggaagtgaaaatgcttatccggaacctgctgaaa
acagagcccactcagagaatgaccatcacagagttcatgaaccatccctggatcatgcaa
tccacgaaggtcccccagaccccactgcacaccagccgggtcttgaaggaagacaaggag
cggtgggaggatgtcaaggaggagatgaccagtgccttggccacaatgcgtgtcgactac
gagcagatcaagataaaaaagatcgaagatgcatctaaccctctgcttctgaagaggcgg
aagaaagctcgggctctggaggcttcggcccttgcccactga

DBGET integrated database retrieval system