KEGG   Heterocephalus glaber (naked mole rat): 101709289Help
Entry
101709289         CDS       T02812                                 

Gene name
Aldh1l1
Definition
(RefSeq) aldehyde dehydrogenase 1 family member L1
  KO
K00289  formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    101709289 (Aldh1l1)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     101709289 (Aldh1l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Formyl_trans_N Formyl_trans_C PP-binding DUF1487
Motif
Other DBs
NCBI-GeneID: 101709289
NCBI-ProteinID: XP_004854215
Position
Un
AA seq 902 aa AA seqDB search
MKIAVIGQSLFGQEVYCHLRKEGHEIVGVFTIPDKDGKADPLGLEAKKDGVPVFKFPRWR
ARGQALPDVVAKYQALGAELNVLPFCSQFIPMEVIDAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFTVFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVEAV
RLISEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACGQ
KLTFFNSTLNTSDLVPEGEDLLIPGAHRPGMVTKAGLILFGNDDRMLLVKNIQLEDGKMI
PASHFFKGAASSALELTEAEVITAEAVRSAWQRILPSVPDIEDSTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMATTFGDFIQLLVRKLRGEDEENECVIDYVEKAVNKLTLYI
PHQLFIGGMFVDAEGTKTYDAINPTDGSVICQVSLAQVSDVDKAVAAAKDAFENGLWGKI
SARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGCTIPINQARPNRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVINILPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMR
SCALSNVKKISLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVENSIH
DQFVQKVVEEVKKMKIGNPLDRDTNHGPQNHQAHLKKLLEYCQHGMKEGATLICGGNQVP
RPGFFFEPTVFTDVEDHMFIAKEESFGPIMIISRFADGDVDTVLSRANATEFGLASGVFT
RDINKALYVSDKLEAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTF
EY
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgctgtgattggacaaagcctgtttggtcaggaagtttactgtcacctaagg
aaggagggtcatgagatagtgggcgtgttcaccatcccagacaaggatgggaaggctgac
cccctaggcctggaggctaagaaggatggagtgccagtgttcaagttcccacgatggcgg
gcacgaggacaagctctgcctgatgtggtggccaaataccaggctttgggtgccgagctc
aacgtcttgccattctgcagccagttcatccccatggaggtcattgatgctcctagacat
ggctccatcatctaccacccatctctgctccccaggcaccggggagcttcagccatcaac
tggacactcattcatggagataagaaagggggctttactgtcttctgggctgatgatggt
ctggacactggggaccttctgcttcagaaggaatgtgaggtgctaccagatgataccgtc
agcactttgtacaaccgcttcctcttccccgaaggcatcaaagggatggtggaggctgtc
aggctcatctcagagggcaaagcccctagactccctcagcctgaagaaggagccacctat
gagggaattcagaagaaggaaacagccaagatcaactgggaccagccagctgaggctatt
cacaattggatccgtgggaatgacaaggtgccaggtgcctggacagaggcttgtggacag
aagctgacatttttcaactcgacgctgaacacatcagaccttgtgccagaaggagaagat
ttgctcatcccaggtgcccatcggccaggcatggtcaccaaagcaggacttatcctcttc
ggaaatgatgacagaatgctactggtgaagaacatacagctagaggatggcaagatgatc
ccagcctcacacttcttcaagggagcagcgagtagtgccctcgagttgacagaggcagag
gtgatcactgcagaggctgtacggagtgcttggcagaggatcctccccagtgttccagac
attgaagattccacggatttcttcaagtcaggagctgcatcagtggatgttgtgaggttg
gtggaagaagtgaaagagctgtgtgatggcctggagttagaaaatgaagatgtttacatg
gcaaccaccttcggggacttcatccagctcttagtgaggaagctgagaggagaggatgaa
gagaatgagtgtgtcattgactatgtggagaaggcagtgaacaagctgactctctacatt
ccgcaccagctcttcatcgggggcatgtttgtggatgctgagggtaccaagacctacgat
gccatcaacccaacagatggaagtgtcatctgccaggtgtccctggcccaggtcagtgat
gttgacaaggcagtggctgcagcaaaggatgcctttgagaatgggctgtgggggaagatc
agcgcacgggaccggggccggctcctatacaggttagcagatctcatggagcagcaccag
gaagaactagccaccattgaggccttggatgccggtgctgtctacacactagccctaaag
actcatgtgggcatgtctatccagaccttccgctactttgctggttggtgtgacaagatc
cagggctgcaccatccccatcaaccaagccagacccaaccgcaacctgaccttgaccaag
aaagagcctgttggtgtctgtggcattgtcattccctggaactatcccctgatgatgctg
tcctggaagacagctgcctgccttgccgctgggaacacagtagtgatcaagcctgcccag
gtaacaccactcacagccttgaagtttgcagagctgacattgaaggctggcattcccaag
ggtgtgatcaacattctcccaggatctggctcactggttggccagagactctcagaccat
cctgatgtgaggaaaattggattcacaggttccacagaggtgggcaaacacatcatgagg
agctgtgccctgagtaatgtgaagaagatttccctggagctgggtgggaagtcacccctc
atcatctttgctgactgtgacctcaacaaggctgtacagatggggatgagctctgtattc
ttcaacaaaggggagaactgcattgcagcagggcggctctttgtagagaactccatccat
gaccagttcgtgcagaaggtggtggaagaggtgaagaagatgaagattggcaatcctctt
gacagagacaccaaccacgggccacagaaccaccaagcccacctaaagaagctgttggag
tattgccagcatggcatgaaagagggggccacactgatctgtggtgggaatcaagtccct
cggccaggtttcttctttgagccaactgttttcacggacgtggaggaccacatgttcata
gccaaggaagagtccttcgggcccatcatgatcatctctcgctttgccgatggggatgtg
gacactgtgctgtctcgcgccaatgccacagaatttggcctggcttctggagtcttcacc
cgggatatcaacaaggccctgtatgtcagtgacaagcttgaagcaggcactgtgtttgtc
aacacatacaacaagactgacgtggctgctccctttggaggattcaagcagtctggattt
ggcaaagatttaggagaggcagccctgaatgaatacctgcgggtcaagacagtgactttc
gagtactga

DBGET integrated database retrieval system