KEGG   Heterocephalus glaber (naked mole rat): 101711589Help
Entry
101711589         CDS       T02812                                 

Gene name
Minpp1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00010  Glycolysis / Gluconeogenesis
hgl00562  Inositol phosphate metabolism
hgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101711589 (Minpp1)
   00562 Inositol phosphate metabolism
    101711589 (Minpp1)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101711589 (Minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101711589 (Minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 101711589
NCBI-ProteinID: XP_004858391
UniProt: G5B5S7
Position
Un
AA seq 491 aa AA seqDB search
MLCGTPGFLRASVAPAAALAAALAAALFSSLAHCSLLEPRDPVTSVLSPYFGTKTRYEDV
NPRLLSDPEAPRRDPELLEGTCTPVQLVALIRHGTRYPTAKQISKLRQLHGLLQARGPAD
GRPGSAGSRGPGAALTDWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFTRENYGR
LRLVTSSKHRCMDSGAAFLQGLWQHYYPGLSPPDVADMECGPPRVNDKLMRFFDHCEKFL
TEVERNATALYHVEAFKTGPEMQNTLKKVAATLEVPVNDLNADLIQVAFFTCSFDLAIRG
VKSPWCDVFDIDDAKVLEYLNDLKQYWKRSYGYTINSRSSCTLFQDIFQHLDKAVEQQQR
SQPVSSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGHIVPYASNLI
FVLYHCENAKTPKEEFQVQMLLNEKVLPLAHSQETVSLYEDMKNHYKDILQNCQTNEECK
LTKVNSTSDEL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgctttgtggtaccccaggcttcctcagggcctccgtagcgcccgccgctgccctggct
gctgccctggctgcagccctgttctcgtcgcttgcgcactgctcgcttttggagccgagg
gacccggtgacttcagtgctcagcccctatttcggcaccaagactcgctacgaggatgtc
aaccccaggctgctgtcggaccctgaggcgccgcggcgggacccggagctgctggagggt
acctgcaccccggtgcagctggtcgccctcatccgccacggcacccgctaccctacggcc
aaacagatcagcaagctgaggcagctgcacgggctgctgcaggcccgtgggccggcggat
ggcaggccgggcagtgcggggtctcgcggcccgggtgccgcgctgaccgactggccactg
tggtacgcggactggatggatgggcagctggtggagaagggacggcaggatatgagacag
ctggcgctgcgcctggcttcactcttcccggccctcttcacccgcgagaactacggccgc
ctgaggctggtcaccagctccaagcaccgctgcatggacagcggcgccgccttcctgcag
gggctgtggcagcactactaccctgggctgtcgccgcctgacgtcgcagatatggaatgt
ggacctccaagagttaatgacaaactaatgaggttctttgatcattgtgagaagttttta
actgaagtggaaaggaatgctacagctctttatcatgtagaagccttcaaaactggacca
gaaatgcagaacactttaaaaaaagttgcagctactttggaagtgccagtaaatgattta
aatgcagatttaattcaggtagctttttttacctgttcatttgacttggcaatcagaggt
gttaaatccccttggtgtgatgtttttgacatagatgatgcaaaggtattagaatattta
aacgacctcaaacaatattggaaaagaagctatggatacaccattaacagtagatccagc
tgtaccctatttcaggatatctttcagcacttggacaaagcagttgaacagcagcaaagg
tctcagccagtgtcttctccagtcatcctccagtttggtcatgcagagacccttcttcca
cttctttctctcatgggctacttcaaagacaaggaacccctaacagcttataattacaag
aaacaaatgcataggaaattccgaagcggccacattgtaccttatgcctcaaacctcata
tttgtgctttaccattgtgaaaatgctaagactcctaaagaagaattccaagtgcagatg
ttattgaatgaaaaggtgttacccttggctcactcacaagaaactgtttcattatatgag
gatatgaagaatcactataaggacattcttcagaattgtcaaaccaatgaagagtgtaag
ttaacaaaggtaaatagcacatcagatgagctctga

DBGET integrated database retrieval system