KEGG   Heterocephalus glaber (naked mole rat): 101713091Help
Entry
101713091         CDS       T02812                                 

Gene name
Pla2g4c
Definition
(RefSeq) phospholipase A2 group IVC
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00564  Glycerophospholipid metabolism
hgl00565  Ether lipid metabolism
hgl00590  Arachidonic acid metabolism
hgl00591  Linoleic acid metabolism
hgl00592  alpha-Linolenic acid metabolism
hgl01100  Metabolic pathways
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04217  Necroptosis
hgl04270  Vascular smooth muscle contraction
hgl04370  VEGF signaling pathway
hgl04611  Platelet activation
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04724  Glutamatergic synapse
hgl04726  Serotonergic synapse
hgl04730  Long-term depression
hgl04750  Inflammatory mediator regulation of TRP channels
hgl04912  GnRH signaling pathway
hgl04913  Ovarian steroidogenesis
hgl04921  Oxytocin signaling pathway
hgl05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101713091 (Pla2g4c)
   00565 Ether lipid metabolism
    101713091 (Pla2g4c)
   00590 Arachidonic acid metabolism
    101713091 (Pla2g4c)
   00591 Linoleic acid metabolism
    101713091 (Pla2g4c)
   00592 alpha-Linolenic acid metabolism
    101713091 (Pla2g4c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101713091 (Pla2g4c)
   04010 MAPK signaling pathway
    101713091 (Pla2g4c)
   04370 VEGF signaling pathway
    101713091 (Pla2g4c)
   04072 Phospholipase D signaling pathway
    101713091 (Pla2g4c)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101713091 (Pla2g4c)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101713091 (Pla2g4c)
   04664 Fc epsilon RI signaling pathway
    101713091 (Pla2g4c)
   04666 Fc gamma R-mediated phagocytosis
    101713091 (Pla2g4c)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101713091 (Pla2g4c)
   04913 Ovarian steroidogenesis
    101713091 (Pla2g4c)
   04921 Oxytocin signaling pathway
    101713091 (Pla2g4c)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101713091 (Pla2g4c)
  09156 Nervous system
   04724 Glutamatergic synapse
    101713091 (Pla2g4c)
   04726 Serotonergic synapse
    101713091 (Pla2g4c)
   04730 Long-term depression
    101713091 (Pla2g4c)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101713091 (Pla2g4c)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101713091 (Pla2g4c)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101713091 (Pla2g4c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 101713091
NCBI-ProteinID: XP_012921620
Position
Un
AA seq 610 aa AA seqDB search
MNPENLSKLPLFNKNSFVVSIIPGLQKEEQEAVEKRGCQVLTALKKLSKDNEAWNLPKAQ
PPVIAVLGSGGGLRAHIACLGVLSELKTLGLLDAVTYLSGVSGSTWALSSFYTKDGNTED
IEAELKHRFDQKEWDFKHSLEKTVEAGKLENYSLTDFWAYIVVSKQTRELQDSCLSSMTK
HVEEGTLPYPIFAAIDDDLHRDHKEKAQNPWFEFTPHHAGYPALGAYIPIAHFGSKFMEG
RLVRPEPERDLSFLKGLWGSALASLEEIKNFILDQLLSLKEKLNMTHLHLKGERFYHEST
EVAGWIDSTGTIVEELLDLAMTYIKDPNAPGILEKLQVLQQKLEAGRRGDDEVSETALRW
LAEMAQDWNNVSPEDQGKFLEQLVQCFMKLEEHSGLSSYPRLFFKDVMSEILDTFKVLIK
TGVCCFKWEWGTIYNFLYKHGDIEEKEMSNRELLHLVDAGFAINSPYPLVLLPARNVQLI
LSFDFSAGDPFETIRSTAKYCHDHKIPFPLLEEAKLKEWSAAPKSCYILKGEKGPVVMHF
PLFNIDTCGADIQKLSETYDTFKMADSYTLDLVTQLLRLSKENVSKNKETILSQIRSMAS
HRLQEEQRNE
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagagaacctctccaaattaccattgttcaataaaaatagctttgtggtttcc
attatccccgggctgcagaaagaagagcaagaggctgtggagaaacgcggctgccaggtg
ctgacggcactgaaaaagctgagcaaggacaacgaggcttggaacctccccaaggcccag
ccacctgtcattgctgttctgggctctggcggggggctgcgggcccacatcgcctgcctc
ggggtcctgagtgagctgaaaactcttggcctgctggatgctgtcacctacctctcaggg
gtctcggggtccacttgggctctgtcttccttttacaccaaggacgggaacacagaagat
attgaggctgagctgaagcatcgatttgaccaaaaggagtgggacttcaagcacagccta
gagaaaaccgtcgaggcagggaagttggagaattactctctgacggatttttgggcctac
attgttgtctccaagcaaaccagggaactgcaggactcttgcttgtctagcatgacgaag
catgtggaggaagggacactcccttacccgatatttgcagccattgatgatgaccttcac
cgtgaccataaggaaaaagcccagaatccctggtttgagttcacaccacaccatgctggc
taccctgcactcggggcctacatccccatcgcccactttggaagtaaattcatggaggga
agactggtcagacctgagcctgagcgagacttgtccttcctgaaaggattatggggaagt
gctctggctagccttgaagaaattaaaaatttcattttggatcagttattgagcctgaaa
gaaaaattgaatatgacacatttacacctgaaaggtgagagattttaccatgaaagcaca
gaagttgctggttggatagacagcactgggaccattgtagaagagctgctggacttggcg
atgacttacataaaagatccaaatgcccccggcatcctggagaagctccaggtcctacag
caaaaactggaggctggaaggagaggggacgatgaagtcagcgagactgcactcagatgg
ctggctgagatggcccaggattggaacaacgtctccccagaagatcaggggaagttcctg
gaacagctggtacaatgcttcatgaaactagaagagcattcaggcctgagttcatacccc
aggctttttttcaaagacgtgatgtccgagatcctggacactttcaaagttctgattaaa
actggagtgtgctgtttcaagtgggaatggggaaccatttacaacttcctgtataaacat
ggtgacatcgaagaaaaggaaatgagcaaccgggaactcctccacctggtggatgctggt
tttgccatcaactctccataccctcttgttctgctccctgcacggaatgtccagctcatc
ctctcctttgactttagtgctggggatcctttcgagaccatcaggtccactgctaagtac
tgccatgaccacaagatcccctttcccctgttggaagaggcaaagttgaaggagtggtca
gcagcccccaaaagctgctacatcctgaaaggggaaaaaggacctgttgtgatgcatttt
cccctgttcaacatagacacttgtggagctgacattcagaaattgagtgagacatatgac
accttcaaaatggctgacagctacacgctagacctggtgactcagctcctgaggctgtcc
aaggagaatgtcagcaaaaacaaggagacgatccttagccagatacggagcatggccagt
cataggctccaagaagagcagagaaatgagtga

DBGET integrated database retrieval system