KEGG   Heterocephalus glaber (naked mole rat): 101713190Help
Entry
101713190         CDS       T02812                                 

Gene name
Tyw3
Definition
(RefSeq) tRNA-yW synthesizing protein 3 homolog
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hgl03016]
    101713190 (Tyw3)
Enzymes [BR:hgl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     101713190 (Tyw3)
Transfer RNA biogenesis [BR:hgl03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    101713190 (Tyw3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 RRXRR
Motif
Other DBs
NCBI-GeneID: 101713190
NCBI-ProteinID: XP_004841494
Position
Un
AA seq 318 aa AA seqDB search
MAPQQGEGGLFPTFGDPTFLLASRNAEEVWTWTAATRSKMAAPRDERGSGELRPLPPSLM
DRSAEFRRWKAQCLSRADLSRKGSVDEDVAHVVQLLNTREQFFTTSSCAGRILLIDGGIN
GFEVQKQNCCWLLVTHKPCVKEDVMVALKKARGNAVLKFEPLVLHVQCQQLQDAQLLHSV
AVDSGFRNSGITVGKKGKTMLAVRSTHGLEVPLSNQGKLMVTEEYIDFLLNIANQKMEEN
KKRIERFYNCLQHALERETITNSHPKIKEKNNPSCSPKKERNPAKAHGKCTLEENDKEIE
NDDDDDPGLGVAVFPEDY
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggctccacagcagggagagggcgggctgtttccaacttttggagaccccaccttcctg
ctcgcttcgcggaatgcggaggaagtttggacctggacggccgccactcgctccaagatg
gccgcccccagggatgaacgtggaagtggagagttgcggcctctaccaccctctctcatg
gatcgcagtgcggagttcaggaggtggaaggcgcagtgtctgagcagagcggacctcagc
aggaagggcagtgtggacgaggatgtagcacacgttgtgcagctcctgaacacgcgggaa
cagtttttcaccaccagttcctgcgcgggccgcatcctcctcatagacgggggtataaat
ggttttgaagttcagaaacaaaactgttgctggctgctggttacacacaaaccttgtgta
aaagaggatgtgatggtagcactgaagaaagccaggggcaatgccgttttgaaatttgag
ccgcttgtccttcacgtgcagtgtcagcagctgcaggacgcgcagcttctgcattcagtg
gcagttgattctggtttcaggaactctggcatcacagtgggaaagaaaggaaagactatg
ttggctgtccggagtacacatggcttagaagttccattaagcaatcagggaaaattgatg
gtgacggaggagtatattgacttcctgttaaatatagcaaatcaaaaaatggaggaaaac
aagaaaagaattgaaaggttttacaactgcctacagcatgctttggaaagagaaacaatc
actaactcacatcccaagatcaaagagaaaaacaacccatcctgttctcctaagaaagaa
agaaacccagcaaaagcacatggcaaatgcacccttgaggaaaatgataaagaaattgaa
aatgatgacgatgacgacccaggactcggtgttgctgtcttccctgaagactactaa

DBGET integrated database retrieval system