KEGG   Heterocephalus glaber (naked mole rat): 101713585
Entry
101713585         CDS       T02812                                 

Gene name
Adamts13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hgl01002]
    101713585 (Adamts13)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     101713585 (Adamts13)
Peptidases and inhibitors [BR:hgl01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   101713585 (Adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_3 Reprolysin_4 TSP1_spondin TSP1_CCN Reprolysin_5 Pep_M12B_propep ADAM_spacer1 Peptidase_M10 Reprolysin_2 DUF4953
Other DBs
NCBI-GeneID: 101713585
NCBI-ProteinID: XP_012929300
Position
Un
AA seq 1516 aa
MSRLRPWARCPLLHAASVGGVLFSAFLALGCWGLSDFQQSFLQALEPEEVSSYFGPDAAL
EVPHFTVAPLTCVCEDQLPTLPCRALRCSLSAPEEPFAFSFRPEQGLLGPSFVTEHVVNA
SLRLLKGPLSHCFTGGRALLPPGTVARVTHCSGHVEGDIQVGAGRLYVQPVKRKHQALVP
PWSGALPHLIHSPAASGFVQADPSPGLWRRTRRRAAGGILHLELLVAVGPDVHQAHQEDT
ERYILTNVNIGSELLRDPSLGVQVRVHLVKLLILTEPEGTPNITANITSSLLSVCEWSRS
VNPEDDKDPGHADLVLYVTRFDLELPDGNRQVRGVTQLGGACSPSWSCLITEDTGFDLGV
TMAHEIGHSLGLDHDGAPGSGCGASGHVMASDGVATTHRGQVWSPCSRRQLQQLLSTGWV
RCMWDLPSSPWGPTGRLPDAQPGLYYGMEEQCRIAFGPAATACTFAREGLDMCQALSCHT
DPLDHSSCSRRLVPLLDGTECGLEKWCFKGHCRSLAELTPVAAVHGSWSSWGPSSPCSRS
CGGGVVTRRRQCDNPRPAFGGRACTGADLQAEMCNTQACEKTQLEFMSEQCAQTDDQPLP
VSPGGTSFHHRGAAVQYSQGDALCRRLCWAGSQSLLVRQGHRLLDGTRCVPSGPQEDRTL
SLCVLGSCRTFGCDGRMDSQQAWDVCRVCGGDNSTCSFRNGSFTAGTAREYVTFLTVTPD
MTGVRIVNRRPLFTHLAVRIRGHYVVAGEGSIAPSTTHPSLLEDSRMEYRVALSEDRLPR
QEEIRIQGPVQEDVEIQVYRRYGEEHGALTRPDVTFTYFQPKQQEVWEWAAERGPCSVSC
GEGLHRVFYSCLDRAQNVWVEATWCQGSPKPPAWVEPCVPMPCPPRQEVSEPGLSTEAGG
AGLALPNVTRGQGAHGPGSPATAGACATHEMPPAGKACVGTVCPPAWAQLSAHPTEDTAT
AEEPADAKLHTRSPEEEPPAAHRWTPELGLCSVSCGRGLMELRFLCTDSVLGTPVQEELC
DLASRPGSRWEVCQPGPCPAQWEARALVPCPVTCGGGRIPLAVRCVRMDHGRPVPLPPSK
CWPTPQPGPFQDCSPEPCPARWKVLSLGPCSASCGLGTATRAVACMRLDQGRDAEVAAAS
CESLVQPLASVPCFLADCTYRWHISPWTECSVSCGDGIQRRRDTCLGPQGQAPLPASFCQ
YLPKPVMVQGCWAGPCEGQGGSSLALHEDATTPSPTMAAAAAASLEWSPPPAQAHLVSPA
FRPPGPQERPAESSVCGRQHLEPTGTIDMRGPGQADCIVAIGRPLGEGVTLQVLESSLNC
SAGESLLLWGRLTWRKVCRDLAGETFASKTNTLVVRQHREQPGDGVVLRYRSQPAAEAFH
RECDLQLFGPRGDILSPRLSPDGRTAGGCRVFISVAPQARVAIHVLATDVGTGTIGSYIS
IRDTHSTRTTTFRGQQALYWESEGSEAEMEFSKDFLEVHAGLRGRYWTLPPRAPEGDPAL
AVSPSRGREARVPDTP
NT seq 4551 nt   +upstreamnt  +downstreamnt
atgagccggcttcggccctgggcacgatgcccccttctccatgcagccagcgttggaggg
gtcctcttcagtgccttcttggccctcggctgctgggggctgtcggacttccagcagagc
tttctgcaggctctggagcctgaggaggtgtcctcttactttgggcctgatgcagccttg
gaagtgccccacttcactgtggccccgctcacctgcgtctgcgaggatcagctcccgaca
ctgccctgcagggccctgcgctgctccctgagtgccccggaagagccctttgccttctcc
ttccggcctgagcagggcctcttgggtccctcctttgtcaccgagcatgtggtgaatgcc
tccctccggctgctgaaagggcccctcagccactgcttcacggggggacgtgccctgctg
cccccgggcacagtggccagggtcacacactgctcaggccatgtggagggcgacattcag
gtgggcgcaggcagactgtatgtccagccagtgaagaggaagcaccaggcgctggtgcca
ccttggagtggggccctgccccacctgatccacagccccgccgcctcgggatttgtgcaa
gcagatccttcccccgggctctggaggcggacacggagacgggcagcagggggcatcctg
cacctggagctgctggtagccgtgggccctgacgtccaccaggctcaccaggaggacacc
gagcgctacatcctcaccaatgtcaacatcgggtcggagctgctgagggacccctccctg
ggggtgcaggtccgagtgcacctggtaaagctgctcatcctcacggagcctgaggggacc
ccgaatatcactgccaatatcacctcgtccctgctgagcgtctgtgagtggagccgttca
gtcaaccctgaggacgacaaggatcctgggcacgctgacctggtcctctacgtcaccagg
tttgacctggagttgcctgatgggaaccggcaggtccggggagtcacccagctggggggt
gcctgctccccctcctggagctgccttatcactgaggacactggctttgacctgggggtc
accatggcccatgagatcggacacagtttaggcctggaccacgatggggcacctggcagc
ggctgtggggccagtggacatgtgatggcctctgacggcgtggccaccacccacaggggc
caggtgtggtccccctgtagccgaaggcagctgcagcagctgctcagcacagggtgggta
cgctgcatgtgggacctgccaagctcgccgtggggacccacagggcgcctgcctgatgct
cagcccggcctctactatggcatggaggagcagtgccgcattgccttcggccccgctgcc
accgcctgcacctttgccagggaggggctggacatgtgccaggccctgtcctgccacacg
gaccccctggaccacagcagctgcagccggcgcctcgtgcctctcctggatgggacagaa
tgcggcttggagaagtggtgcttcaagggtcactgccgctccctggcggaactgacgccc
gtggctgccgtgcacgggagctggtccagctggggccccagcagcccttgctcccgctcc
tgtggaggaggtgtggtcaccaggaggcggcagtgtgacaaccccaggcctgccttcggg
gggcgtgcgtgcaccggggccgacctgcaggctgagatgtgtaacactcaggcctgcgag
aagacgcagctggagttcatgtccgagcagtgcgcccagaccgacgaccagccgctaccc
gtctccccggggggcacctccttccaccaccggggtgctgcagtgcagtacagccaaggg
gacgctctgtgcagacgcttgtgctgggctggcagccagagcctccttgtgcggcaagga
caccggctcctggacgggacccggtgtgtgcccagcggcccccaggaggacaggaccctg
agcctgtgcgtgttgggcagctgccggacatttggctgtgacggccggatggactctcag
caggcgtgggacgtgtgccgggtgtgtggaggggacaacagcacgtgcagcttccggaat
ggctctttcacagcggggacggccagagaatatgtcacattcttgacagtcacccccgac
atgactggggtgcgcatcgtcaaccgcaggcccctcttcacgcatttggcagtgaggatc
cgagggcactacgttgtggctggggaaggcagcatcgcgcccagcaccacccacccatcc
ctcctggaggacagccgcatggagtacagagtggccctctctgaggaccggctaccccgc
caggaggagatccgcatccagggacccgtccaagaagacgtggagatccaggtgtacagg
cggtatggcgaggagcatggtgccctcacccgcccagatgtcaccttcacctacttccag
cccaagcagcaggaggtgtgggagtgggctgcggagcgtgggccctgctccgtgagctgt
ggggaagggctgcaccgggtgttctacagctgcctggaccgggcccagaatgtgtgggtg
gaggccacttggtgtcaagggagcccgaaaccacccgcctgggtagagccctgcgtcccc
atgccctgccctcctaggcaggaggtgtcagagcccggcctgagcaccgaggctggggga
gcaggcctggccttgcccaatgtgacccgtgggcagggtgcccatggcccgggctcacca
gcgactgcaggggcctgtgccacccacgagatgccacctgctggcaaggcctgtgttggg
acggtgtgtcctccggcctgggctcagctctcggcccaccccacggaggacactgccact
gccgaggagcctgcagatgccaagctgcacaccaggtctccagaggaggagcctccagcc
gcacacaggtggactcctgagctagggctgtgctctgtctcctgtggtcgaggactgatg
gagctgcgattcctgtgcacggactcagtccttgggacgcctgtgcaggaggaattgtgt
gacttggccagcaggcctgggagccggtgggaggtgtgccagcctggcccgtgccctgcc
cagtgggaggcccgggccttggtgccatgtcctgtgacctgcggaggcgggcggatcccc
ctggctgtgcgctgcgtgaggatggaccacggccgccctgtccctctgcctccctctaag
tgctggcccacaccccagcccggccccttccaggactgcagcccggagccctgcccggcc
aggtggaaagtcctgtccctaggcccatgctcagccagctgtggcctgggcactgcgaca
cgtgcagtggcctgcatgaggctggaccagggccgggacgcagaggtggctgcagcttcc
tgtgagtcgttggtgcagccgctggccagtgtcccctgcttcctggctgactgcacctat
cggtggcacatcagcccctggacagagtgctccgtctcctgtggggacggcatccagcgc
cggcgtgacacctgccttggaccgcagggccaggcacccctgccggccagcttctgccag
tacttgcccaagccagtgatggtgcaggggtgctgggctgggccctgtgagggacagggg
ggctccagcctggcgctccacgaggatgccaccactccaagcccaaccatggctgccgct
gctgctgcttctctggagtggtccccgcccccggcccaggcccacctcgtctcccctgct
tttcggcctccagggccccaggagaggccagcagagtccagtgtctgtggcaggcagcac
ctggagcctacgggaaccatcgacatgcgaggccctggccaggcagactgtattgtggcc
attgggaggccgctgggtgagggggtgaccctccaggtcctcgagagttccctcaattgc
agcgcaggggagtccttgctgctctggggccggctcacctggaggaaggtgtgcagagac
ctggccggcgagacttttgcctccaagaccaacacgctggtggtgcgacagcaccgagag
cagccgggggatggagtggtgctccggtaccggagccagcctgcggcggaagccttccac
agagaatgcgacctccagctctttggcccccggggtgatatcctgagcccccgactgagt
ccagatgggaggactgcaggtggctgccgggtcttcatcagcgtggctccgcaggcccgc
gttgccatccatgtcctggccaccgacgtgggcactgggaccattggcagctacatctca
atccgggacacccacagcacaaggaccacgaccttccgtgggcagcaggcgctctactgg
gagtcagagggcagtgaggctgagatggagttcagcaaggacttcctggaggtgcatgct
ggcctgcgaggccggtactggaccctccccccgagggcgccggagggggaccctgcccta
gcggtctctccaagcagaggaagggaagccagggtgcctgacactccctga

DBGET integrated database retrieval system