KEGG   Heterocephalus glaber (naked mole rat): 101715249Help
Entry
101715249         CDS       T02812                                 

Gene name
Pik3cb
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00562  Inositol phosphate metabolism
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04070  Phosphatidylinositol signaling system
hgl04071  Sphingolipid signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04140  Autophagy - animal
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04210  Apoptosis
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04218  Cellular senescence
hgl04360  Axon guidance
hgl04370  VEGF signaling pathway
hgl04380  Osteoclast differentiation
hgl04510  Focal adhesion
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04611  Platelet activation
hgl04620  Toll-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  Jak-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04668  TNF signaling pathway
hgl04670  Leukocyte transendothelial migration
hgl04722  Neurotrophin signaling pathway
hgl04725  Cholinergic synapse
hgl04750  Inflammatory mediator regulation of TRP channels
hgl04810  Regulation of actin cytoskeleton
hgl04910  Insulin signaling pathway
hgl04914  Progesterone-mediated oocyte maturation
hgl04915  Estrogen signaling pathway
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04923  Regulation of lipolysis in adipocytes
hgl04926  Relaxin signaling pathway
hgl04930  Type II diabetes mellitus
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease (NAFLD)
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04960  Aldosterone-regulated sodium reabsorption
hgl04973  Carbohydrate digestion and absorption
hgl05100  Bacterial invasion of epithelial cells
hgl05142  Chagas disease (American trypanosomiasis)
hgl05146  Amoebiasis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  HTLV-I infection
hgl05167  Kaposi's sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05418  Fluid shear stress and atherosclerosis
Module
hgl_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101715249 (Pik3cb)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101715249 (Pik3cb)
   04015 Rap1 signaling pathway
    101715249 (Pik3cb)
   04012 ErbB signaling pathway
    101715249 (Pik3cb)
   04370 VEGF signaling pathway
    101715249 (Pik3cb)
   04630 Jak-STAT signaling pathway
    101715249 (Pik3cb)
   04668 TNF signaling pathway
    101715249 (Pik3cb)
   04066 HIF-1 signaling pathway
    101715249 (Pik3cb)
   04068 FoxO signaling pathway
    101715249 (Pik3cb)
   04070 Phosphatidylinositol signaling system
    101715249 (Pik3cb)
   04072 Phospholipase D signaling pathway
    101715249 (Pik3cb)
   04071 Sphingolipid signaling pathway
    101715249 (Pik3cb)
   04024 cAMP signaling pathway
    101715249 (Pik3cb)
   04151 PI3K-Akt signaling pathway
    101715249 (Pik3cb)
   04152 AMPK signaling pathway
    101715249 (Pik3cb)
   04150 mTOR signaling pathway
    101715249 (Pik3cb)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101715249 (Pik3cb)
  Cell growth and death
   04210 Apoptosis
    101715249 (Pik3cb)
   04218 Cellular senescence
    101715249 (Pik3cb)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101715249 (Pik3cb)
   04550 Signaling pathways regulating pluripotency of stem cells
    101715249 (Pik3cb)
  Cell motility
   04810 Regulation of actin cytoskeleton
    101715249 (Pik3cb)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101715249 (Pik3cb)
   04620 Toll-like receptor signaling pathway
    101715249 (Pik3cb)
   04625 C-type lectin receptor signaling pathway
    101715249 (Pik3cb)
   04650 Natural killer cell mediated cytotoxicity
    101715249 (Pik3cb)
   04660 T cell receptor signaling pathway
    101715249 (Pik3cb)
   04662 B cell receptor signaling pathway
    101715249 (Pik3cb)
   04664 Fc epsilon RI signaling pathway
    101715249 (Pik3cb)
   04666 Fc gamma R-mediated phagocytosis
    101715249 (Pik3cb)
   04670 Leukocyte transendothelial migration
    101715249 (Pik3cb)
   04062 Chemokine signaling pathway
    101715249 (Pik3cb)
  Endocrine system
   04910 Insulin signaling pathway
    101715249 (Pik3cb)
   04923 Regulation of lipolysis in adipocyte
    101715249 (Pik3cb)
   04915 Estrogen signaling pathway
    101715249 (Pik3cb)
   04914 Progesterone-mediated oocyte maturation
    101715249 (Pik3cb)
   04917 Prolactin signaling pathway
    101715249 (Pik3cb)
   04926 Relaxin signaling pathway
    101715249 (Pik3cb)
   04919 Thyroid hormone signaling pathway
    101715249 (Pik3cb)
  Digestive system
   04973 Carbohydrate digestion and absorption
    101715249 (Pik3cb)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101715249 (Pik3cb)
  Nervous system
   04725 Cholinergic synapse
    101715249 (Pik3cb)
   04722 Neurotrophin signaling pathway
    101715249 (Pik3cb)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101715249 (Pik3cb)
  Development
   04360 Axon guidance
    101715249 (Pik3cb)
   04380 Osteoclast differentiation
    101715249 (Pik3cb)
  Aging
   04211 Longevity regulating pathway - mammal
    101715249 (Pik3cb)
   04213 Longevity regulating pathway - multiple species
    101715249 (Pik3cb)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101715249 (Pik3cb)
   05230 Central carbon metabolism in cancer
    101715249 (Pik3cb)
   05231 Choline metabolism in cancer
    101715249 (Pik3cb)
   05205 Proteoglycans in cancer
    101715249 (Pik3cb)
   05203 Viral carcinogenesis
    101715249 (Pik3cb)
   05210 Colorectal cancer
    101715249 (Pik3cb)
   05212 Pancreatic cancer
    101715249 (Pik3cb)
   05225 Hepatocellular carcinoma
    101715249 (Pik3cb)
   05226 Gastric cancer
    101715249 (Pik3cb)
   05214 Glioma
    101715249 (Pik3cb)
   05221 Acute myeloid leukemia
    101715249 (Pik3cb)
   05220 Chronic myeloid leukemia
    101715249 (Pik3cb)
   05218 Melanoma
    101715249 (Pik3cb)
   05211 Renal cell carcinoma
    101715249 (Pik3cb)
   05215 Prostate cancer
    101715249 (Pik3cb)
   05213 Endometrial cancer
    101715249 (Pik3cb)
   05224 Breast cancer
    101715249 (Pik3cb)
   05222 Small cell lung cancer
    101715249 (Pik3cb)
   05223 Non-small cell lung cancer
    101715249 (Pik3cb)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101715249 (Pik3cb)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101715249 (Pik3cb)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101715249 (Pik3cb)
   04931 Insulin resistance
    101715249 (Pik3cb)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101715249 (Pik3cb)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    101715249 (Pik3cb)
   05166 HTLV-I infection
    101715249 (Pik3cb)
   05162 Measles
    101715249 (Pik3cb)
   05164 Influenza A
    101715249 (Pik3cb)
   05161 Hepatitis B
    101715249 (Pik3cb)
   05160 Hepatitis C
    101715249 (Pik3cb)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101715249 (Pik3cb)
   05169 Epstein-Barr virus infection
    101715249 (Pik3cb)
   05165 Human papillomavirus infection
    101715249 (Pik3cb)
   05146 Amoebiasis
    101715249 (Pik3cb)
   05142 Chagas disease (American trypanosomiasis)
    101715249 (Pik3cb)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    101715249 (Pik3cb)
   01524 Platinum drug resistance
    101715249 (Pik3cb)
   01522 Endocrine resistance
    101715249 (Pik3cb)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101715249 (Pik3cb)
Membrane trafficking [BR:hgl04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101715249 (Pik3cb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 DUF4381 Tom37_C DUF4135
Motif
Other DBs
NCBI-GeneID: 101715249
NCBI-ProteinID: XP_004834387
UniProt: A0A0P6J4N7
Position
Un
AA seq 1070 aa AA seqDB search
MCFSFIMPPAMADILDIWAVDSQIASDGSIAVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHSYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRRKMRKFSEEKIQSLVGLSWIDWLKQTYPPEH
DPSILENLEDKLYGGKLIVAVHFENSQDVFSFHVSPNVNPIKINELAIQKRLTIHGKEDE
ASPGDYVLQVIGRVEYVFGDHPLIQFQYVRNCVVNRALPHFVLVECYKIKKMYEQEMIAI
EAAINRNSSNFPLPLPPKKTRIISHVWDNNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNETLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYHYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAISVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCIILSELYIEKCKYMD
SKMKPLWLVYTNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSDEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttcagtttcataatgcctcctgctatggcagacatccttgacatctgggcagta
gattcacaaatagcttcggatggctccatagctgtggatttccttttacccactgggatt
tatatccagttggaggtaccacgggaagctaccatttcctatattaagcagatgttatgg
aagcaagtgcacagttacccaatgtttaacctgcttatggacattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggaacttgaagatgaaacacgaagactttgc
gatgttagaccttttcttccagttctcaagttagtgacaagaagttgtgatccaggggaa
aaattggactcaaaaattggagtccttataggaaaaggtctgcatgaatttgatgcctta
aaggatcctgaagtgaatgaatttcgacgaaaaatgcgcaaattcagtgaggaaaagatt
cagtcacttgtgggattatcgtggattgactggctaaagcaaacctacccaccagaacat
gatccatccatccttgaaaacttggaagacaagctttatggaggaaagctcattgtagct
gttcattttgaaaatagtcaggatgtgtttagctttcatgtatctcctaatgtgaatcct
ataaagataaatgaattggcaatccaaaaacgtttgactattcatgggaaggaagatgaa
gccagccctggtgactatgtgttacaagtcattgggagagtagaatatgtatttggtgat
cacccactcattcagttccagtacgtccggaactgtgttgtgaacagggccctgccccat
tttgtgcttgtggaatgctacaagatcaagaagatgtatgagcaagaaatgattgccata
gaggctgccataaaccggaattcatctaactttcctcttcccttaccaccaaagaaaaca
cgaattatttctcatgtttgggacaataacaaccctttccaaattgttttggttaaggga
aataaacttaacactgaagaaactgtaaaagttcatgtcagggctggtctttttcatggt
actgagcttctgtgtaaaaccatcgtaagctcagagatatcagggaaaaatgatcacatt
tggaatgaaacactggaatttgatattaatacttgtgacttgccaagaatggctcgatta
tgttttgctgtttatgcagttttggataaagtaaaaacgaagaaatcaaccaaaactatt
aatccttctaaatatcagaccatcaggaaagctggaaaagtgcattatcctgtagcatgg
gtaaataccatggtttttgactttaaaggacagttgaggtctggagacataatattgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctctgcacattaaatttccagagaataaaaaa
caaccttatcattaccctcccttcgataagattattgaaaaggcagctgaaattgcaagc
agcgatagtgctaatgtatcaagtcgaggtggaaaaaagtttcttgctgtactgaaagaa
atcttggacagggatcccttgtctcagctgtgtgagaatgaaatggatcttatttggact
ttgcgacaagactgcagagagaatttcccacagtcactgccaaaattactcctgtcaatc
aagtggaataaacttgaagatgttgctcagctccaggcactgcttcagatttggcctaaa
ctgcccccgagggaggccctggagcttctggatttcaactatccagatcagtatgtacgg
gaatatgcagtgggctgcctgcgtcagatgagtgatgaagaactctctcaatatctttta
caactggtccaagttttaaaatatgagccttttcttgattgtgcactttctagatttcta
ttagaaagagcacttgctaatcggagaatagggcagtttctattttggcatctcaggtca
gaggtgcacattcctgccatctcagtacagtttggcgtcatccttgaagcgtactgtcga
ggaagtgtagggcacatgaaagtgctttccaagcaggttgaagcactcaataaattaaaa
actttaaatagtttaatcaaactgaatgcagtgaagttaaacagagctaaagggaaggag
gccatgcacacttgtttaaaacagaatgcttaccgggaagccctctctgatttgcagtca
cctctgaatccatgtatcatcctctcagagctctatattgaaaagtgcaaatacatggat
tccaaaatgaagcctttgtggctcgtatataccaataaggtatttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaggatatgttgactctccaaatgctg
cgcttgatggatttactctggaaagaagctggtctggaccttcggatgctgccttatggc
tgtttagcaacaggagatcgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgctgcagcggccttcaataaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaagag
tttaccctatcctgtgctggctactgtgtagcttcttatgtcctcgggattggtgacaga
catagtgacaacataatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaaatctaaatttggcattaaaagagaacgagtgccttttattctt
acttatgatttcattcatgtcattcaacaaggaaaaacaggaaacacggaaaagtttggc
cgatttcgccagtgttgtgaagatgcatatttgattttacgaagacatggaaatctcttc
atcactctctttgcactgatgttgactgcagggcttcctgaacttacatcagtcaaggat
atacagtatcttaaggactctcttgccttaggaaagagtgatgaagaagcactcaaacaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtgaactggatg
gctcacactgttcggaaagactacagatcttaa

DBGET integrated database retrieval system