KEGG   Heterocephalus glaber (naked mole rat): 101715697
Entry
101715697         CDS       T02812                                 

Gene name
Cfl2
Definition
(RefSeq) cofilin 2
  KO
K05765  cofilin
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04360  Axon guidance
hgl04666  Fc gamma R-mediated phagocytosis
hgl04810  Regulation of actin cytoskeleton
hgl05133  Pertussis
hgl05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101715697 (Cfl2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101715697 (Cfl2)
  09158 Development and regeneration
   04360 Axon guidance
    101715697 (Cfl2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    101715697 (Cfl2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101715697 (Cfl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101715697 (Cfl2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hgl04812]
    101715697 (Cfl2)
   04147 Exosome [BR:hgl04147]
    101715697 (Cfl2)
Membrane trafficking [BR:hgl04131]
 Others
  Actin-binding proteins
   Others
    101715697 (Cfl2)
Cytoskeleton proteins [BR:hgl04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     101715697 (Cfl2)
Exosome [BR:hgl04147]
 Exosomal proteins
  Proteins found in most exosomes
   101715697 (Cfl2)
SSDB
Motif
Pfam: Cofilin_ADF Ribosomal_S2
Other DBs
NCBI-GeneID: 101715697
NCBI-ProteinID: XP_004867629
UniProt: A0A0P6JD92
Position
Un
AA seq 166 aa
MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI
GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcatctggagttacagtgaatgatgaagtcatcaaagtttttaatgatatgaaagta
aggaaatcttctacacaagaggagatcaaaaagcgaaagaaagcagttctcttctgctta
agcgacgacaaaagacaaataattgtagaggaagcaaagcagatcttggtgggtgacatt
ggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctgaatgattgc
cgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaagacctagta
tttatattctgggctcctgaaagtgcaccgttaaaaagcaagatgatttatgctagctct
aaagatgccattaaaaagaaatttacaggtattaaacacgagtggcaagtaaatggcttg
gatgatattaaggaccgttcaacacttggagagaaactgggaggcaatgtagtagtttca
cttgaaggaaaaccattgtaa

DBGET integrated database retrieval system