KEGG   Heterocephalus glaber (naked mole rat): 101715799Help
Entry
101715799         CDS       T02812                                 

Gene name
Atg16l1
Definition
(RefSeq) autophagy related 16 like 1
  KO
K17890  autophagy-related protein 16-1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04136  Autophagy - other
hgl04140  Autophagy - animal
hgl04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101715799 (Atg16l1)
   04136 Autophagy - other
    101715799 (Atg16l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101715799 (Atg16l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101715799 (Atg16l1)
   03029 Mitochondrial biogenesis [BR:hgl03029]
    101715799 (Atg16l1)
Membrane trafficking [BR:hgl04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    101715799 (Atg16l1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    101715799 (Atg16l1)
Mitochondrial biogenesis [BR:hgl03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    101715799 (Atg16l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 KASH_CCD SH3_2 TolB_like
Motif
Other DBs
NCBI-GeneID: 101715799
NCBI-ProteinID: XP_004868156
Position
Un
AA seq 643 aa AA seqDB search
MSSSLRAADFPRWKRHIAEELRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEK
HDVPNRHEISPGHDGTWNDSQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQQK
DREIQMNEAKIAECLQTVSDLETECLDLRCKLQDLEIANQTLKDEYDALQITFTALEEKL
RKTTEENQELVNRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDI
EVIVDETSDHTEETSPVRGISRAASKRLSQPAGGLLDSITNIFGLSDSPLLGHHSSDAAR
RRSVSSFPVPQEVPVDAHPSPGKDVRVPTTALCVFDAHDGEVNAVQFSPGSRLLATGGMD
RRVKLWEVFGDKCEFKGALSGSNAGITSIEFDSAGAYLLAASNDFASRIWTVDDYRLRTG
CEDGAHQRLTMPPSLSQHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIK
TVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESVVREMELLGKITALDLNPERTELL
SCSRDDLLKVIDLRTSTVKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSVL
TGKVEKTLSKQHSSSINAVAWAPSGLHVVSVDKGSKAVLWAQP
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgagcctccgcgctgccgacttccctcgctggaaacgccacattgctgaggag
ctgaggcgccgcgatcggctgcagaggcaggcgttcgaggagatcatcctgcagtataac
aagttgctggaaaagtcagatcttcattcagtgttggcccagaaactacaagctgaaaag
catgatgtaccaaaccggcatgaaataagtcctggacatgatggcacatggaatgacagt
cagctacaggaaatggcccagctgaggattaaacaccaggaagaactcactgaattacac
aagaaacgtggggagttagctcagttggtgatcgacctgaataaccagatgcagcagaag
gacagggagatacagatgaatgaagcaaaaatcgcggaatgtttgcagaccgtctctgac
ctggagacagagtgcctggacctgcgctgcaagctccaggacctcgagatcgccaaccag
accttgaaggacgaatatgacgccctgcaaatcaccttcaccgccttggaggagaaattg
aggaaaactactgaggagaaccaggagctggtcaacaggtggatggccgagaaggcccag
gaggccaaccgccttaatgctgagaacgaaaaggactccaggcggcggcaagcgcgacta
cagaaggagctcgcggaagcagcgaaggagcctctgccagtagaacaggatgacgacatt
gaagtcatcgtggatgagacctctgatcacacagaggagacctctcctgtgcgaggcatc
agcagagccgcctctaagcgactctcgcagcctgctggaggccttctggattctatcact
aatatctttggtctgtccgactctccccttttgggacatcactcttctgatgctgccagg
agacgctctgtctcttccttcccagtcccccaggaggtacctgtggatgctcatcctagt
cctggtaaagacgtgagagtgccgactactgccctgtgtgtcttcgatgcacacgatggg
gaagtcaatgccgtgcagtttagtcccggctcccggctgctggccacaggaggcatggac
cggcgggtcaagctgtgggaagtatttggagacaaatgtgagttcaagggtgccctatct
ggcagtaatgctggaattacaagcatcgaatttgatagtgccggagcttacctcttagca
gcttcaaatgactttgcaagccgaatctggactgtggatgactatcgattacggactggc
tgtgaggatggggctcaccagaggctcaccatgccgccttctctctcccagcacacactc
acaggccacagtgggaaagtgctgtctgccaagttcctgctggacaatgcacggatcgtc
tcgggaagtcatgaccggaccctcaaactctgggacctgcgcagcaaagtctgcataaag
acggtgtttgcaggatccagttgcaatgatattgtctgcacagagcaatgtgtgatgagc
gggcattttgacaagaaaattcgtttctgggacatccgatcagagagtgtggtccgggag
atggagctgctggggaagatcaccgccctggacctgaacccggagcggactgagctgctg
agctgctcccgggacgacctgctgaaagtcatcgatcttcggacgagcaccgtgaagcag
accttcagtgcacccggcttcaagtgcggctcagactggaccagagtggtcttcagccct
gacggcagttacgtggcagcaggctcagccgagggttcgctgtatgtctggagcgtgctc
acagggaaagtggagaagacactgtcaaagcagcacagctcctccatcaacgcggtggcg
tgggccccctccggcctgcacgtcgtcagcgtggacaaaggcagcaaagctgtgctgtgg
gcacagccatga

DBGET integrated database retrieval system