KEGG   Heterocephalus glaber (naked mole rat): 101717863Help
Entry
101717863         CDS       T02812                                 

Gene name
Ttn
Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl05410  Hypertrophic cardiomyopathy (HCM)
hgl05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    101717863 (Ttn)
   05414 Dilated cardiomyopathy (DCM)
    101717863 (Ttn)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101717863 (Ttn)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101717863 (Ttn)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hgl04812]
    101717863 (Ttn)
   04147 Exosome [BR:hgl04147]
    101717863 (Ttn)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101717863 (Ttn)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   101717863 (Ttn)
Membrane trafficking [BR:hgl04131]
 Others
  Actin-binding proteins
   Others
    101717863 (Ttn)
Cytoskeleton proteins [BR:hgl04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     101717863 (Ttn)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101717863 (Ttn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Ig_6 Pkinase fn3_4 C1-set Titin_Z Pkinase_Tyr Izumo-Ig Adeno_E3_CR1 PPAK THB Ig_4 DarA_N
Motif
Other DBs
NCBI-GeneID: 101717863
NCBI-ProteinID: XP_012922280
Position
Un
AA seq 34254 aa AA seqDB search
MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD
GRARLMIPAVTKANSGRYSLRATNGSGQATSTAELLVTAETAPPNFTQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEVVPAKKTKTIVSTAQISETRQTRIEKKIEAHFDARSIATVEMV
IDEATGQQLPHKAPPRIPPKPKSRSPTPPSLTTKAQLARQQSPSPVRHSPTPVRHVRAPT
PSPVRSVSPAGRISTSPIRSVKSPLLIRKTQAATMATGPEVPPPWKQEGYVASSTEAEMR
ETRVMSSTQIRREERWEGRFGVQEQVTITGAAGAAASVAASAHFAAGAVTAGAKEVKQEA
DKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTTAVRVQPAQEQVRKEAEKTAITKV
AVAADKTKEQEVRTREVITTKQEQTHATHEQIRKETEKAFIPKVVISATKAKEKETRITG
EITTKQEQKQITQETLRMEAEKMSISKLIVNTAEAAEPVTLPRTTEGFAVKQEPIHLFQK
EMKTHAAEVGAGKKAEAVATVVAAVDQARVREPREPGHLEESYAQQTTLEYGYKEHVSTT
KVPEHPQRPASEPQVVPKAVKPVVIQAPSETYVKTTDQMGMHISSQIKKTTDLTTERLVH
VDKRPRTASPHFTVSKITVPKTEHGYEASLAGSAIATLQKELSVTSAQKITKSVKAPTVK
PGETRVRPEPTPSPQFPFADMPDTYKSQAGIEVRKEVGVSITGTTVREERLKVLHGREAK
VTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPKVTWYREDYQIES
SIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFDKETTVA
EKYTAEEKRFVESRDVVMMDTSITEEQAGPGEPTAPFFITKPVVQKLVEGGSVVFECQVG
GNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGEIS
ASASLLEEADYESLVRSQQEMLYQTQTTAFVQEPKVGEIAPGFIYSDYEKEYEKEQALIR
KKMAKDTVMVRTFVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDREEKMAVDISES
EAVESGFDLRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGR
ASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGVPTYIPTPEPVSRIRSVS
PRSVSRSPIRMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPAPFKCLEG
QTARFDLKVVGRPMPETFWFHNGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVV
AQNRAGKSSISVTLTVEAAEHQIKPAFVEKLKNVNIKEGSRLEMKVRAMGNPNPDIVWLK
NSDIIVPHKYPRIRIEGTKGEAFLKIDSTASQDSAWYTATAINKAGRDTTRCKVNVEVEF
AEPEPERRLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTS
LRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRD
SGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGV
TTDQKEKQKPDIVLFPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRY
DGIHYLDIVDCKSYDTGEVKVTAENPEGVTEHKVKLEIEQREDFRSVLRRAPEPKPEFHV
HEPGKLQFEVQKVDKPVDTTETKEIVKLKRAERITHEKVSEESEELRSKFKRRTEEGYYE
AITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIEL
SPSMEAPKIFERIQSQTVGLGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPED
NVCELVIRDVTAEDSSSIMVKAINIAGETSSHAFLLVQAKQLITFTQALQDVVAKEKDTM
ATFECETSEPFVKVKWYKDGIEIYTGNKYRMHSDRKVHFLSVLTIDSSDAEDYSCVLVED
ENIKTTAKLIVEGAVVEFVKELQDIEVPESFSGELQCIVSPENIEGKWYHNNVELKSNGK
YSITSRRGRQNLTVKDVTKEDQGEYSFVVDGKKTTCKLKMKPRPIAILQGLSDQKVCEGD
IVQLEVKVSLENVEGVWMKDGQEVQHGDRVHIVIDKQSHMLLIEDMAKEDAGIYSFTIPA
LGLSTSGHVSVYSVGVITPLKDINVIEGTKAVLECKVSVPDVTSVKWYLNDEQVKPDDRV
QAIVKGTKQRLVINRTYASDEGPYKLMVGRVETSCNLSVEKIKIIRGLRDMTCTETQNVV
FEVELSHSGIDVLWNFKDKEIKPSAKYKIEAHGKIYKLTVLNMMKDDEGEYTFYAGENMT
SGKLTVSGGAISKPLVDQTVAESQEAVFECEVANPDSEGEWLKDGKHLPLSNNLRSESDG
HKRRLIIAATKLDDVGEYTYKVATSKTSAKLRVEAVKIKKTLKNLTVTETQDAIFTIELT
HPNVRGVQWIKNGVVLESNDKYDISVKGTTYSLKIKNCAIVDESVYGFRLGRLGASARLH
VETVKIIKKPKDVTALENATIAFEVSVSHDTVPVKWFHRNVEIKPSDKHRLVSERKVHKL
LLQNISPSDAGEYTALVGQLECKAKLFVETLHITKTMKSIEVPETKTASFECEVSHFNVP
SMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSSEDSAEYTFVCGNDQVSATLTVTPIMI
TSMLKDINAEEKDTITFEVTVNYEGVSYKWLKNGVEIKSTDKCQMRTKKLTHYLNIRNVH
FGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWM
KDGQELQIADRMKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNMSSATLFVEGRDVRIRS
IKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERYQYVVERRIHRMFISETR
HSDAGEYTFVAGRNRSSVTLYVNAPEPPQILQELQPTTVQSGKPARFCAVISGRPQPKIS
WYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVP
EVVSPDQEMPVYPPTIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFK
MTQFEDTYQLEVAEAYPEDEGTYTFVASNAVGQVSSTANLRLEAPESMLYEGIEQQVEME
MKAFSSFLSAEEELQSYSSDLQLSNTNETLELLSEPPVHSSEFDSKNAGSAPIFTREVSN
AEISMGDVAKLSVTATAIPKPKIQWFFNGVILTPSADYKFVFDGDDHSLIILFTKLEDEG
EYTCMASNEYGKTTCSAYLKIHPKGEGHKETETEATVETSLEKLEGPCPPYFLKELKPVR
CAPGLPAVFEYKVYGDPAPTVLWFKENKQLCTNVYYTIIGNPDGSGTFIVNDPQVKDRGL
YVCKAENVWGESTCAAELRVLLEDPDMTDAPCRAESTSEAPDNIPEMLLQSSAEEAFNSK
QEITVFIKDTILKAALIAEEMQQISYDHTVKTNGLSSEATLEAEQLRSMVMLEEDMPIPA
STRELPPRDSTMHVQPSKEPPPKLQLQIVQSQKTLAKEDTLLFQEPEKIFPSVSSIEQIS
SVTVEPLTTLTAGPERSYPQPSAEPPAHSHPSFVAEEVLLLKEQTVSEVGKGQRVTLQKQ
EAQSALILSQSLAEGHPESFQAPEILTSNITSEPQVPSEHTCTEDGKILMESVDQLENVG
HNFGIRIEEGKSLRFPLALEEKQVLFKEEHADDTATPTTQTTEYAKEPVVMKGVQEVQGS
DILSKENLLPSIPEEQGLNLKAQIRRALQAAVASEQPGLFSEWLRNIETVEVKAITFTQE
PKRIMCTYLITSLKALTEEVTIAIEGIDPQTANLKTELKDALCCIVCEEINILTAEEPRM
QKGSTINMHEEVDSFSESQKVEAITEPQVKSKYLVSMQEVSCSTVESQVKDTDTTAATEE
VVPAALSKQAQHETLKPPEEKEKPSESGESGTKETRRVEIQEVKHSIIKEDPPVIHTPLV
DTVSEEGDVVYLTSSITNAKEVNWHFEGKLVLSDQKFKCFQDENTYTLIIDTVNAEDHQG
EYVCEASNDNGKTTTSAKLTVIKRAAPVIRRRIEPLEVALGHLAKFTCEIHSAPNVRFQW
FKAGKEIYESDKCSIRSANYVSSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAY
PPAFVSRPKSLTTFVGKAVKFLCTVSGTPVIETIWQKDSAALSPSPNCKISQAENKHGLE
LSNLTVQDRGIYSCKASNKFGADTCQAELIVIDKPHFIKQLEPVQSAINKKVRLECQVDE
DRKVTIAWIKDGQKLPPGKDYKIYFEDKIASLEIPLAKLKDSGTYVCTASNEAGGSSSSA
TVTIREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMSFF
NNSEAVLDIMDVKVEDSGSYSCEAMNDVGSDSCSTEIVIKEPPSFIRTLEPADIVRGTNA
LLQCEIAGTGPFEISWFKDKKQIRSSKKYRLFSQKSVVSLEIFSFNSADVGEYECVVANE
VGKCGCSATHLLKEPPTFVKKVDDFTALAGQTVTLQAAVRGSEPISVTWMKGQEVIREDG
KIKMSFSNGVAVLTIPDVQISFGDKYVCRAENEAGSQTSVGELIVKEPAKIVERAELIQV
TAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNIAQLKFYSAELHDSGQYT
FEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVSGTCRLDCKIAGSLPMRVSWFK
DGKEISSSDRYRIAFVEGTASLEISRVDMSDAGNFTCRATNSVGSKDSSGALIVQEPPSF
VTKPGSRDVLPSSAVCLKSTFQGSTPFTIKWFKGDKELVSGGSCYITKEASESSLELYAV
KTSDSGTYTCKISNVAGSVECSANLFVKEPATFIEKLEPSHLLKKGAATQLACKVTGTPP
IKITWFANDREIKESSKHRMSFVESTAVLSLTDVAVEDSGEYMCEAQNEAGSDHCSSVII
VKESPYFTQEFKPIEVLKEYDVVLLAEVAGTPPFEITWFKDNTTLRSGRKYKTFMQDQLV
SLQILKFVATDAGEYQCRVTNEVGSSTCSAKVTLREPPSFVKKIESTSSLRGGTAAFQAT
LKGSLPITVTWLKDNEEITEDDNIRMTFENNVASLYLSGIEVKHDGKYICQAKNDAGIQR
CSAVLSVKEPATIIEEAVSIDVTQGDPATLQVKFSGTKDITAKWFKDGQELTLGPKYKIS
VTDTVSILKIVSTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIK
GSFIDLECIVAGSHPISIQWFKDDREISASDKYKFSFHDNTAFLEISQLEGTDSGTYTCS
ATNKAGHNQCSGHLTVKEPPYFMEKPQSQDVNPKTRVQLKALVGGTAPMTIKWFKDNKEL
HSGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGIATSKTTLFVKEPPQFIKKPS
PVLVLRNGQSTTFECQITGTPEIRVSWYLDGNEVTDIRKHGISFVDGSATFQISGARVEN
SGTYVCEARNDAGTASCSIELKVKEPPSFLRELKPVEVVKESDVELECEVTGTSPFEVTW
LKDNKEIRSGKKYTLSDRVSVFSLHITKCDPSDTGEYQCIVANEGGSCSCNARVSLKEPP
SFIKKIENVTTVLKSSATFQSAVAGSPPISISWLKDDQILDEDDNVRVSFVNNVATLQVR
SVDSGRSGRYTCQAKNESGVERCFAFLLVQEPAQIIEKAKSVDVTEKDPVTLECVVGGTP
ELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYL
RVLDENIPPSFIKKLTKMDKMLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCH
ENTVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPDRQQAVPDSTVE
FKAVLKGTPPFKIKWFKEDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCQVTNDV
GSDSCTTMLLVTEPPKFVKKLEASKVVKAGDSTRLECKIIGSPEIRVVWYRNEHELPVSD
KYRMTFIDSVAVLQMNNLGTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPVVET
LKNTEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHASIHILNVESSDIGEYH
CKAQNEVGSDTCICTIKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKE
VIRESENIRITFVENVVTLQFAKAEPANAGKYICQIKNDGGIRENMATLTVLEPAVIVEK
AGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLKIVSIERQ
DAGTYTFQVQNNVGKSSCMAVVDVSDRMVPPSFTRRLRDTGGVLGTSCILECKVAGSSPI
SVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRALLTV
QEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVGWFRGARELVKGDRCNIYFEDTVAE
LELFNIDISQSGEYTCVVSNNAGQTSCTTRLFVKEPAVFVKKLSDHSVEPGRSIILEGTY
SGTLPISVTWKKDGFNITPSERCSIVTTEKTCILEILNSTKRDAGHYSCEIENEAGRDVC
DALISTLEPPYFVTELEPLEAAVGDTVSLQCQVAGTPEITVSWYKGDTKLRSTPEYRTYF
TNNVATLVFNKVDINDSGEYTCIAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVG
LPVTLTCRLNGSSPIQVCWYRDGVLLRDDENLQTSLVDNVATLKILQTDLSHSGQYSCSA
SNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNK
EIRPGGNYTITCVGNTPHLRILKVGKGDTGQYTCQATNDVGKDMCSAQLSVKEPPKFVKK
LEASKVAKQGESIHLECKISGSPEIKVSWFRNDSELHESWKYNMSFTDSVALLTINEASA
EDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPAPIGALQGSDVVLQCEISGTPPFEV
VWVKDRKQVRSSKKFKITSKNFDTSLHILNLEASDLGEYHCKAANEVGSDTCVCSVKFKE
PPRFVKKLSDTSTLTGDTVELRAVVEGFQPISVVWLKDKGEVIRETENIRISFTDNVATL
QLVSPEASNSGKYVCQIKNDAGKRECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVVA
GTRELSAKWFKDGRELSADSKHHITFVKNVASLKIPCAEMSDKGLYSFEVKNSVGKSNCT
VSVHVSDRIVPPSFIRKLKDTSAVLGGSTVLECRIAGSAPISVGWFQDGNEILSGPKCQS
SFSENVCTLNLSLLDPSDTGTYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGT
SLTFTSVIRGTPPLKIQWFKGSRELVSGESCTISLEGFVTELELLEVEPLQSGDYSCLVT
NDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLEATFTGTPPISVTWIKNEYALSQ
SQNCSITMTEKSTILEILESTVEDYAQYSCLIENEAGQDICDALVSVLEPPYFIEPLEYV
EAAIGEPITLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGE
YTCKAENSVGAVASSNVLIIKERKLPPSFARKLKDVHETLGFPIAFECRINGSEPLQVSW
YKDGVLLKDDSNLQTSFVHNVATLQILQTDQSHVGQYNCSASNPLGTASSSAKLILSEHE
VPPFFDLKPISVDLALGESGSFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATL
TVLKVAKGDAGQYTCYASNVAGKDSCSAQLGVQEPPRFIKKLESSRIVKQDESMRYECKI
GGSPEIKVLWYKDETEIQESSRFRMSFVDSVAVLEMHNLSVEDSGDYTCEARNAAGSASS
STSLKVKEPPIFRQKPHPVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMS
ENYLTSIHILNVDAVDTGEYQCKATNDVGSDTCIGSITLKAPPRFVKKLSDISTIIGEEV
QLKTTVEGPEPISVVWFKDKGEIVRESDNIWISYSDNIATLQFSRAEPANAGKYTCQIKN
DAGMQECFATLSVLEPAAIVEKPGSVKVTTGDTCTLECTVAGTPELTTKWFKDGKELTSD
SKYKISFFNKVSGLKIINVVPSDSGVYSFEVQNPVGKDSCTASVQVSDRIIPPSFTRKLK
ETNGLSGSSIVMECKVYGSPPISVSWFHEGNEVSSGRKYQTTLTDNTCALTVNMLEESDA
GDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPMDVLTGTDVTFTSIVKGTPPFSVSWF
KGSSELVPGARCNVSLEDTVAELELFDVDTSQSGEYTCIVSNEAGRASCTTHLFVKAPAK
FVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPS
SMVEDAGQYNCYIENASGKDSCSAQILILEPPYFIKQLEPIKVTVGDSASLQCQLAGTPE
IGVSWYKGDTKLRPTTTCKMHFRNNVATLVFTQVDTNDSGEYICRAENSVGEVSSSTFLT
VQEQKLPPSFSRQLRDVQETVGLPVVFECAINGSEPISVSWYKDGKPLKDSSNVQTSFLD
KVATLNIFKTDRSLSGQYSCTATNPIGSSSSSARLILTEGKNPPFFDIPLGPMDAVVGES
ADFECHITGTQPIKVSWAKDSREIRSGGNYQISYLENSAHLTILKVDKGDSGQYTCYAVN
EVGKDSCTAQLNIKERLIPPSFTKKLSETVEETEGNSFKLEGRVAGSQPIGVAWYKNNVE
LHPTSNCEITFKNNTLLLQVKKAGMADAGLYTCKVSNDAGSALCTTSIVIKEPKQPPVFD
QHLTPITASEGEFVQLSCHVRGSEPIRVQWLKAGREIKPADRCSFSFASGTAVLELKDVV
KEDSGDYVCKASNVAGSDTSKSKVTIKEKPAAAPAAKKAAVDGNLFFVSEPQSIRVVEKT
TATFIAKVGGDPIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTSKTDSGLYRCVA
FNKHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPVLKKGTGEEEEIDIMELLKNIDPK
EYEKYARMYGITDFRGLLQAFELLKQSQTEETHRLEIEELEKSEKDEKEFEELVSFIQQR
LTQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLSWYKGTEKLEPSDKFEISIHG
DRHTLRVKNCQLKDQGNYRLVCGPHIASAKLTVIEPAWERHLQDVTLKEGQTCTMTCQFS
VPNVKSEWFRNGRILKPQGRFKTEVEHKAHKLTIADVRAEDQGQYTCKHEDLETSAELRI
EAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKGPMELTESQKYNFRNDGRCHY
MTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTKEIKLELKPPDIPDSRVPIPTMPI
RAVPPEEVPPAVAPSIPLLLPLPEEKKPPAKRVEVTKKAVKKDTKKVIPKPKEEAPPPKE
VAKKPPPPTALIPAKAPEIIDVSSKAEEVKITTITRKKEVQKEREAVYEKKQAVYEEKKV
YIESMVEEPYDELEVEPYTEPYEEPYYEEPDEDYEEIKVEAKREVHEEWEDDFEEEQEYY
ERKEGYDEGEEEWEESYQEREVIKVQKEVREELAERKIPAKVPEKKVPPPKVLKKPVVEK
VEKTTRRMEEEKVQVTKVPEVSKKIVPQKPSRTPVQEEIIEVKVPAVHTKKMVISEEKMF
FASHTEEEVSVTVPEVQKKTVTEEKIHVAVSKKIEPPPKVPEPPKKPVPEEEVPVPIPKK
VEPPPAKVPEVPKKPVPEEKKPVPVPKKEPAAPPKVPEVPKKTVPEAKVPVPLAEKKEVP
PAKVPEVQKRVITEEKVTIITQREESPPPAEPEIPKKKVPEEKRPVPPKEEETPPRKVPA
VPKKPVPEEKVPVPVPVAKKAPPPRAEVSKKTVVEEKRFVGEEKLSFAVPQRVEVMRHEG
ISPEEEWSYSEEEERVSVSVYREEEREEEEEEVEITEYEVMEEPEEYVVEEKLHIISKRV
EAEPAKVPEKKIISKPEVPAKVEERPPLKVPEPPKKIIPEKKVPAPIPKKEKVPPPAVPE
EPKKPVPEKRVPPKEVKIEEPPPAKVTERHMQITQEEKVLVAVTKKEEPPRARVPEEPKR
AVPEEKLPKLKPRREPEPPAKVTELRKRVIAEEKVSIEVPEREPRPTKEVSVTEEKKWSY
TREEEIVSEQREEEYEAYEEYEDYKEFEEYEPTEEYDQYEDYEEREFEHYEEYKEHEEYI
TEPEKPIPVKPVQEEPVPTKPKPPPAKVPKKAVPEEKVPVPVPKKLRPPPPKVPEEPKKV
VEEKIHISITKREKQQVTEPAARVPMKPKRVIPEAKVPVPKKEVAAPVRVPEVPKKREPE
EVAFEEEAETYEEEYFYVHEEEEYLHEEEEHITEEEVVPVIPIKVPEVPKKPVPEEKKPV
PVPKKKEVPPAKVPEVPKKPEEKAPVPIPKKEKAPPAKVPEVPKKPVPEEKVPVPVPKKV
EAPPAKVPEVPKKPVPEKKVPVPAPKKVEAPPAKVPEVPKKLIPEEKKPTPVLKKMEAPA
PKVPKKREVVPVPVALPQEEEEEEEVPFEEEIAPEEEILPEEEEVLPEEEEEVIPPEEEE
VPPEEEELVHEEEEVPEEEEVLPEIKPKVPVPAPVPEVKKKVTEKKVVVTKKEEAPPAAV
PEVPEKVEERQIIPPKEEEVPPVEVFEEPEEPIPEEIPEEPPSIEEVEEVEPPRVPEVVK
KIIPEAPTPVPKKVEAPPAKVPEKISEEKVPVPVQKKEAPPAKVPEKKVPEKKVPEKKVL
IPKKEAVTPAKGRTVLEEKVSFAYEQEEVVKQRIEFEVAEAEVEEVLEDQFHEVQEYFEE
EEFHEVEEFIKVEERRFEEHKVDKVHRVIEFLEAEEVEVYEKPKAPPKGPEIAEKIIPPK
KPPTKVVPREEPPTKVPEVTKKIVVEEKVLVPESPEYPPTEVPEAPKESVPEKKVPKIPP
KKPEAPPVTVPEAPKEVVPEKKVPVAPPKKPEIPPAKVPEVPKAAVPVKKVPEAVPPKPE
SPPPEVPEVPPKEAIPEKKVPVAPPKKPEAPPPKVPEVPEEIVHEKKVPMVPPKKPEAPP
VTVPEVPKAAVPVKKVPEAVPPKPESPPPEVYEEEAEEIAPEEPPIEVLEEPEPVEVPEE
PEPAAPPKVMVPPKKPVPEKKAVVAKKPEPPPVKVPEVPKEVVPEKKMPRVVPKKPEVPP
AKVPEVAKEVVPEKKVTVPQKPEVPPPKVPEVPKKPVIEEKPAVPVPEKVESPPPEVYEE
PEEIAPEEEEPVPVVEEEEPEAPPPPEPEEPKKTVPEKKFPVIKKPEPPPPKEPEPEKKV
IEKPKLKPRPPAPAPPPPKEDVKEKMFQLKAVTKKKVPEKPEVPEKVELTPVKVPGAEKK
VRKLLPEPKPQPKEEVVLKSVLRKKPEEEEPKVEPKKVEKIKKPEVPAPPPKEVEAPPAV
TTRERKIPEPTKVPEIKPAIPLPGPEPKPKPEPEVKTIKPPPVEPAPTPIAAPVTVPVVG
KKAEAKAPKEEAAKPKGPIKGVAKKTPSPIEAERKKLRPGSGGEKPPDEAPFTYQLKAVP
LKFVKEMKDIVLTEAESVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRK
LHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLIVEELPVRFVKTLEEEVTVVKGQPLYLSC
ELNKERDVVWRKDGKILVEKPGHIVPGIIGLMRALTINDADDTDAGTYTVTVENANNLEC
SSCVKVVEIIRDWLVKPIRDQHVKPKGTAVFSCDIAKDTPNIKWFKGYDEIPMEPTDKTE
ILKEGNHLYLKIKNAMPEDIDEYAVEIEGKRYPAKLTLGDREVELLKPIEDVTIYEKESA
SFDAEISETDIPGQWKLKGELLRPSPTCEIKQEGGKRFLTLHKVKLDQAGEVLYQALNAI
TTAILTVKEIELDFAVPLKDVTVPERRQARFECVLTREANVIWSKGPDIIKASDKFDIIA
DGKKHILVINDSQFDDEGVYTAEVEGKKTSAQLFVTGIRLKFISPLEDQTVKEGETATFV
CELSHEKMHVVWFKNDNKLHTTRTVLMSSEGKTHKLEMREVTLDDISQIRAQVKNLSSTA
HLKVLEADPYFTVKLHDKTGVEKDDIILKCEVSKDVPVKWFKDGEELVPSPKHSIKTDGL
RRILKIKKAELKDKGEYVCDCGTDTTKANVTVEARLIKVEKPLYGVEVFVGETARFEIEL
SEPDVHGQWKLKGEPLTASPDCEIIEDGKKHVLVLYNCQLDMTGEVSFQAANAKSAANLK
VKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITSDDKFELIKDGTRH
SMVIKSAAFEDEAKYMFEAEDKRTSGKLIIEGIRLKFLTPLKDVTAKERENAVFTVELSH
DNIPVSWFKNDQRLHTSKRVSMDDAGKMHSITFKDLSIDDTSQIRVEAMGISSEAKLTVL
EGDPYFTGKLQDYTGVEKDEVVLQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRML
ILKKALKSDIGQYTCDCGTDQTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDD
IHANWKLKGEALLQTPDCEIKEEGKIHFLILHNCRLDQTGGVDFQAANVKSSAHLRVKPR
VIGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDTVVTRSEGRVHTLTL
RDVKLEDAGEVQLTAKDFKTQANLFVKEPPVEFTKPLEDQTVEEEATAVLECEVSRENAK
VKWFKNGTEILKNKKYEIVADGRVRKLIIHNCTPEDIKTYTCDAKDFKTSCNLNVVPPHV
EFLRPLTDLQVKEKEMARFECEISRENAKVQWFKDGAEIKKGKKYDIISKGAVRILVINK
CLLNDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANVEVSETDTIKLVCEVSKPGAEVI
WYKGDEEIIETGRFEILADGRKRILTIQNAHLEDAGNYNCRLPSSQTDGKVKVHELAAEF
ISKPQNLEILEGEKAEFVCTISKESFEVQWKRDDKTLEAGDKYDVIADGKKRVLVVKDAT
LQDMGTYVVMVGAARAAAHLTVIEKLRIIVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFR
NEEAIFDSAKYIILQKDLVYTLRIRDTRLDDQAKYNVSLTNHRGENVKSAADLIVEEEDL
RIIEPLKDVETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRISYRIDKYKHSLIIKD
CGFPDEGEYVVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVK
WYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVEI
IRPPQDILEAPGADVVFLAELNKDKVEVQWLKNNMVIVQGDKHQMMSEGKIHRLQICDIK
PRDQGEYRFVAKDKEARAKLELASAPKIKTADQDLVVDVGQPLTMVVPYDAYPKAEAEWF
KENEALSSKTVDTTAEQTSFRILEAKKGDRGRYKIVLQNKHGKAEAFINLQVIDVPGPVR
NLEVTETFDGEVGLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRADSCEFTVTGLQ
KGGVEYLFRVSARNRVGTGEPVETDNPVEARGKYDVPGPPLNVTITDVNKFGVSLTWEPP
EYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVG
KPSAATPFVKVADPIERPSPPVNLNSSDQTQSSVQLTWEPPLKDGGSPILGYIIERCEEG
KDNWIRCNMKPVPKLTYKVTGLQKGNNYLYRVSAENAAGVSDPSEILGPLTADDASVEPT
MDLSAFKDGLEVIVPNPVKILVPSTGYPRPTATWSFGEKVLEAGDRVTMKTISAFAELVI
SPSERPDKGIYTLTLKNRVKSISGEINVNVIARPSAPKELKFTDITKDSVHLTWEPPDDD
GGSPLTGYVIEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAY
IDEPVNMSAPATVPDPPENLKWRDRTAKSIFLTWEPPKNDGGSRIKGYLVEKCPRGSDRW
VACGEPVAETKMEVTGLEEGQWYAYRVKALNRVGASKPCRPTEEIQAVDTQEAPEIFLDV
KLLAGLTVKAGTKIELPATVTGKPDPKITWTKADLVLKQDNRITIENVPKKSTVTIMDSK
RSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDITSESCLLTWNPPRDDGGSK
VTNYVVERKATDSEVWHKLSSTVKDTNFKATKLTPNKEYIFRVAAENMYGVGEPVQATPI
IAKYPFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNK
MPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSRSTEPILIKDPIDPPWPPGKPTVKD
IGKTSLTLTWTKPEHDGGAKIESYVIEMLKTGTEDWVRVAEGVPTTQHLLPGLMEGQEYS
FRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSP
ITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDS
VLAKDTFTTPGPPYALTVVDVTKRHVDLKWEPPKNDGGRPIQRYIIEKKEKLGTRWVKAG
KTSGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILTIEDPTSPPSPPLDLHVT
DAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGIIPDK
EYVLRVRAVNAVGVSEPSEISENVVAKDPDCKPTIEMETHDIVVIEGEKLSIPVPFRAVP
VPTVSWHKDGKEIKASDRLTMKNDHISAHLEVPKSVHADAGIYTITLENKLGSATASINV
KVIGLPGPCKDIKASDVTKSSCKLTWEPPEYDGGSPILHYILERREAGRRTYIPVMSGEN
KLSWTVKDLIPNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAK
AMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPVLTYTAKGLEEGKEYQFRV
RAENAAGIGEPSRATPPTKAVDPIDAPKVILRTILEVKRGDEIALDATISGSPYPTITWI
KDENVIVPEEIKKRPAAPVRRKRGEVQEEEPFFLTLTERLSINNSKQGESQLRVRDSLRP
DHGLYMIKAENDHGVAKAPCTVCVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEII
NYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRLGPGPPCVSKPL
TAKDPFEPPDAPDKPIVEEVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKS
LLNSLKAKVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPQTARDPISPPGPPIPRVADTS
STTIELEWEPPAFNGGGEIIGYFVDKQLVGTNEWSRCTEKMIKDRQYTVREIREGADYKL
RVSAVNLAGEGPPGETEPVTVAEPLEPPAVELDVSVKAGIQIMAGKTLRIPAVVTGRPVP
TKVWTIEEGELDKDRVVIENVGTKSELIIKNALRKDHGRYVITATNSCGSKFAAARVEVF
DVPGPVLDLKPVVTNRKMCLLNWSDPADDGGSELTGFIIERKDAKMHTWRQPIETERSKC
DITGLLEGQEYMFRVIAKNKFGCGPPVVIGPILAVDPLGPPTSPERLTYTERTKSTITLD
WKEPRSDGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNE
IGESEPSLPLNVVIQDDEVPPTIKLRLAVRGDTIKVMAGEPVSIPADVTGLPMPKIEWSK
NEKVIEKPTDALKITTEEVSRSEAKTELSIAKAVREDKGTYTVTASNRLGSVFRNVHIEV
YDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKSEWEEVTNTAV
ERRFGIWKLIPNGQYEFRVRAVNKYGTSDECKSDKVVIQDPYRLPGPPGKPQVLERTKGS
MLVSWTPPLDNGGSPITGYWLEKREEGGAYWSRVSRAPITKVGLKGVEFNVPRLIEGVKY
QFRAMAINAAGIGPPSEPSDPALAGDPIYPPGPPSRPEVKDKTKSTISLAWKPPAKDGGS
PIKGYIVEMQEEGSTDWKPVNEPDKLIPTCEYTVPNLKELRKYKFRVKAVNEAGESEPSD
TTGEIPATDVQEVPEVFIDIGAQDCLVCQAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAM
KDGIHDIPEDAQLETAENSSVIIIPECKRSHSGKYSITAKNKAGQKTANCRVKVMDVPGP
PKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNCGSTSFVVPD
LISEQQYFFRVRAENRFGVGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKP
PKNDGGSPVTHYIVECLAWDPTGTKKEAWKQCNKRDVEELEFTVEDLIEGGEYEFRVKAV
NAAGVSKPSSTVGPVTVKDQTCPPSIELKEFMEVEEGTDVNIVAKIKGVPFPTLTWFKAP
PKKPDNKEPVVYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVL
GRPGPPVGPIKFESVSADQMTISWLPPLDDGGSKITNYVIEKREANRKTWVRVSSEPKEC
MYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGPPDKPTVSSVTRDSMT
VNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFR
VYAINAAGVGPASLPSDPVTARDPIAPPGPPFPKVTDWTKSSVDLEWSPPLKDGGSRVTG
YIVEYKEEGKDEWEKGKDKEVRGTKLVVTDLKEGAFYKFRVRAVNIAGIGEPGEVTDIIE
MKDRIVVPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWSMNERALPQEAAIEST
AISSSMVIKNCQRSHQGVYSLLAKNAGGERKKTIIVDVLDVPGPVGEPFLSDTLTNDSCK
LTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTCTVTRQSAVVQGLTEGKSYFFRIAAEN
SVGMGPFVETPNALVIRDPITVPERPEELQVKEVTKDSVTLTWKPPKYDGGSEIINYVLE
SRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDE
LAPPTLDLDFRDKLTVRVGEAFALTGHYSGKPQPKVSWFKDEVDVLEDDRTHIKTTPTTL
ALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDCPGPPVGPVHFDEVTKEYMVISWK
PPLDDGGSEITNYIIEKKEVGKDVWMPVTSACAKTTCKVPKLLEGKDYIFRIYAENLYGI
SDPLVSDSMKARDRFRVPDAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKKETMS
KRWARVTKEPIHPYTKFRVPDLLEGCQYEFRVSAENEVGIGDPSPPSKPVFARDPIAKPS
PPVNPEAIDTTCNSVDLMWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETSY
KVTGLRDGQTYKFRVFAVNEAGESDPANVPEPVLIKDRLEPPDLILDANMAREQYIKVGD
TLRLSAVIKGVPFPKVTWKKGDREAPTKAQIDVTPVGSKLEIRNAAHEDGGIYSLTVENP
AGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERKDVASA
QWSPLSTTSKKKSHLAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPK
DLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGAQDWTKFKTVKNLECVVTGLQQ
GKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAII
RGVPVPTAKWTTDGSEIKTDDHYTVETDSYSSVLTIKNCLRKDTGEYQITVSNAAGTKTM
PVHLTVLDVPGPPTGPINLLDITPEYMTISWQPPKDDGGSPVINYIVEKKDTRKDTWGVV
SSGSSKMKLKIPHLQKGYEYVFRVRAENKMGVGPPLDSTPTVAKHKFSPPSPPGKPVVTD
ITENAATVSWTLPKSDGGSPITGYYIERREITGKWVRVNKTPIADLKFRVTGLYEGNTYE
FRVFAENLAGLSNPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSP
ILGYVVECQKPGTAQWDRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELA
ESMVAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWSKEGKVLTRDKR
VDLIHDLPRVELQIKEAVRSDHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLRVSNVT
KENCTLSWENPLDNGGSEITNFIVEYRKPNQKGWSIIASDVTKRLIKANLLANNEYYFRV
CAENKVGVGPTTETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLS
YHVERRLKGCADWERVHKGSIKETHYMVDKCVENQIYEFRVQTKNEGGESDWVKTEEVVV
KEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVVWTKDKDATDLTRSPRVKIDT
GADSSKFSLSKARRSDGGKYIITATNTAGSFVAFATVNVLDKPGPIRNLKITDVSSDRCT
IRWDPPEDDGGCEIQNYILEKCESKRMVWSTYSATVLTPGTTVTRLIEGNEYIFRVRAEN
KIGTGPPTESKPVIAKTKYDRPGRPDAPEVTKISKEEMTVVWNPPEYDGGKSITGYYLEK
KEKHAVRWVPVNKTAIPERRMKVQNLLPGHEYQFRVKAENEIGIGEPSLPSRPVVAKDPI
EPPGPPTNLKVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAA
AQLVRMEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPREILEPPEIDLDASMRK
LVIVRAGCPIRLFAIVRGRPAPRVTWRKVGIDNVVRRGQVDLVDTMAFLVIPNSTRDDSG
KYSLTLVNPAGEKAVFVNVRVLDTPGPVSNLKVSDVTKTSCHVSWAPPENDGGSQVTHYI
VEKREAERKTWSTVTPEVKKTSFHVSNLVPGNEYFFRVTAVNEYGPGVPTDIPKPVLASD
PLSEPDPPRKLEVTEMTKNTAALAWLPPLRDGGAKIDGYIISYREEDQPEDRWTEYSVVK
DLSLVVSGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGK
KLRIEAYVYGKPHPICKWKKGEDDVVTSSHLVVHKTDNSSVLIIKDVTRKDSGYYSLTAE
NSSGTDTQKIKVIVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDV
SRGDWVTALASVTKTSCRVGKLIPGQEYMFRVRAENRFGISEPLTSPKMLAKFPFGVPSE
PKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKERNSLLWVKANDTAVRSTEFPCA
GLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPEVTDVTKSSASLIWARPK
HDGGSKIIGYFVEACKLPGDKWVRCNTTPHQIPQEEYTATGLEENAQYQFRAIAKTAVNI
SPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGT
PVKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPAS
VKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSSTIPITSCSVEKLIE
DHEYQFRICAENKYGVGDPIFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADD
GGSPITGYLLEKREMQAVNWTKVNRKPVIERTIKATGLQEGTEYEFRVTAINKAGPGKPS
DASKAVYAQDPLYPPGPPAFPKVYDTTHSSVSLSWGKPAYDGGSPIIGYLVEVKRVDSDH
WVRCNLPEKLQKMRFEVTGLIENTEYQFRVYAVNKIGYSDPSDVPDKHCPKDILIPPEGE
LDAELRKTLILRAGVTMRLYVPVRGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCE
NVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEVSKDSAYVTWDPPIIDG
GSPIINYVVEKRDAERKSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGET
RDAVKASETPGPVVDLKALSVTKSSCTIGWKKPRSDGGSRITGYAVDFLTEDNKWQRVMK
SLSLQYTTKDLSEGKEYTFRVCAENDNGEGTPSEVTVMAKDDVVAPDLDLKDLPDLCYLA
KENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESTAVNTTLVVYDCQKSDAGKYT
ITLKNVAGTKEGTLSIKVVGKPGIPTGPIKFDEVTAEAVTLKWAPPKDDGGSEITNYILE
KRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIIAKHPFD
VPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHIEFKERNSLLWKRANKTPIRMKD
FKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINVTRNSVTLIW
TEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPDCAFTVTDLVEGGKYEFRIRAKNTA
GAISAPSESTGTIICKDEYEAPTIVLDPTIKDGLTVKAGETIVLSAISILGKPLPKSSWS
RAGKDIRPSDISQITSTPTSSTLTVKYSSRKDAGEYTITATNPFGTKEEHVKVTVLDVPG
PPGPIEISNVSAEKATLTWTPPLEDGGSPIKSYVLEKRETSRLLWTVVAEDIQSCRHVVT
KLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMVDRFGPPGPPGKPEISNVTKNTATVSWKR
PTDDGGSEITGYHVERREKKGLRWVRATKTPVSDLRCKVTGLQEGNTYEFRVSAENRAGI
GPPSDASNPVLMKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKV
GDEAWIKDTTGAALRITQFVVPDLQTKEKYNFRISAVNDAGVGEPAVIPNVEIVEREMVP
DFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDGVNMKNRANIENTESFTLLII
PECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLKPTDITKDSVTLHWDLPLID
GGSRITNYIVEKREATRKSYSTVTTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTE
TTEPVKASEAPSPPDSLNIMDITRSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWSHI
TTVKGLECVVKNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKL
IIARAGENIKVEIPVLGRPKPTVTWKKGDQVLKQTQRVNVENTAMSTILNINECVRSDSG
PYPLTAKNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNY
VVEMRQTDSTTWVELATTVIRTTYKATRLTTGVEYQFRVKAQNRYGVGPGITSASVVASY
PFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGIQWQTVSKALVP
GNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPVFALDPIDPPGKPIPLNITRHTVA
LKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAK
NAAGAISPPSEPSDAITCRDDIEAPRIMVDVKFKDTVILKAGEAFKLEADVSGRPPPTME
WTKDGKELEGTAKLEIKIADFSTHLINKDSSRKDSGAYILTATNPGGFAKHIFNVRVLDR
PGPPEGPLAVSDVTAEKCVLSWLPPLDDGGAKIEHYIVQKRETSRLAWTNVASEVQVTKL
KVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVDPYGPPDPPKNPEVTAITKDSMIVC
WGHPDSDGGSEIINYIVERRDKAGQRWVKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENA
AGISAPSSTSPFYKACDAVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEI
ALPEEDEWQIVTPPSGLKATSYTITGLIENQEYKIRIYAMNSEGLGEPALVPGTPKAEDR
MLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWAREHGESLDKASIESTSSYT
LLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWEP
PLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIG
LPAETAESVKVSERPLPPGKITLVDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDK
WTTCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPTFKLLF
NTFTVLAGEDLKVDVPFIGRPTPAVTWHKDDVPLKQTTRVNAESTENNSLLTIKEACRED
VGHYIVKLTNSAGEATETLNIIVLDKPGPPTGPVKMDEVTADSITLSWEPPKYDGGSSIN
NYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPIVA
QYPFKVPGPPGTPFVTFSSKDSMEVQWHEPVSDGGSRVIGYHLERKERNSILWVKLNKTP
IPQTKFKTTGLEEGIEYEFRVSAENIVGIGKPSKASECYVARDACDPPGRPEAIIVTRNS
VTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTQFEVTGLIEDHRYEFRVI
ARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTVVIHAGESFKIDADIHGKPIPT
TQWIKGDQELSNTARLEIKSTDFATSLSVKDAARVDSGNYILKAKNVAGERSVTVNVKVL
DRPGPPEGPVGISGVTAEKCTLAWKPPLQDGGSDITNYIVERRETSRLVWTVVDANVQTL
SCKVTKLLEGNEYIFRIMAVNKYGVGEPLESEPLIAKNPFVVPDAPKAPEVTTVTKDSMI
VVWERPASDGGSEILGYVLEKRDKESIRWTRCHKRLIGELRLRVTGLIENHNYEFRVSAE
NAAGLSEPSPPSTYQKACDPIYKPGPPNNPKVMDITRSSVFLSWSKPIYDGGCEIQGYIV
EKCDVSVGEWTMCTPPTGINKTNIEVEKLVEKHEYNFRICAINKAGVGEHADVPGPVVVE
EKLEAPDIDLDLELRKVINVRAGGSLRLFVPIKGRPTPEVKWGKMDGEIRDAAIIDVTSS
FTSLVLDNVNRYDSGKYTLTLENSSGMKSAFVTVRVLDTPSPPINLKVTEITKDSVSITW
EPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYG
IGLPAHTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHS
EKWSECARVKSLEAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIIAKDLVIEPDVRP
SFSSYSVQVGQDLKIEVPISGRPKPTITWTKDDLPLKQTTRINVTDSLDLTTLTIKETHK
DDSGFYGITVANVVGQKTASIEIITLDKPDPPKGPVKFDEVSAESVTLSWQPPLYTGGCQ
ITNYIVQKRDTTTTVWDIVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESEPV
VAQYPYKEPGPPGTPFAVSISKDSMVIQWHEPISNGGSPIIGYHLERKERNSILWTKVNK
TIIHDTQFKVLNLEEGIEYEFRVYAENIVGVGKPSKNSECYVARDPCDPPGTPEPIIVKR
NEITLQWTKPVYDGGSMITGYIVEKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFR
VIAKNAAGAVSKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVYGKPL
PTIEWLRGDKEVEESTRCEIKNTDFKALLIMKDAIRIDGGQYILRASNVAGSKSFPVNVK
VLDRPGPPEGPVQVTGVTADKCTLAWAPPLQDGGSDISHYVVEKRETSRLAWTVVASQVV
TNSLKITKLLEGNEYIFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNVAKDS
MTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVS
AENAAGVGEPSPATIYYKACDPVFKPGPPTNAHIVDTTKSSITLAWGKPIYDGGSVVLGY
VIEICKADEEEWKIVTPQTGLRVTRFEISKLIEHQEYKIRLCALNKVGLGEAASVPGTVK
PEDKLEAPELDLDSELRKGIIVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKVQIEKG
VNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLTVKEIRKDSVLL
VWEPPIIDGGAKVRNYVIDKRESTRKAYANVSTKCNKTSFKVENLTEGAIYYFRVMAENE
FGVGIPVETTDAVKASEPPSPPGKVTLTDVSQTSAALMWEKPEHDGGSRILGYVVEMQPK
GTEKWSVVAESKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSF
KLPFNTYTVQAGEDLKIEIPVIGRPRPKISWVKDDEPLKQTTRVNVEETATSTILHIKES
SKDDFGKYTITATNSAGTATENLSIIVLEKPGPPIGPVKFDEVSSDFVVISWEPPAYTGG
CQISNYIVEKRDTTTTTWHVVSATVARTTIKITKLKTGSEYQFRIFAENRYGKSTSLDSK
PVIVQYPFKEPGPPGTPFVTSVSKDQMLVEWHEPVNDGGSKVIGYHLEQKEKNSILWVKL
NKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVI
TRNSVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYE
FRVIARNAAGNLSEPSESSGAITARDEIDAPNASLDPKYKDVIVVRAGETFVLEADIRGK
PIPDIIWSKDGRELEETAARMEIKSTIQKTTLIVKDCIRTDGGQYILKLSNVGGTKSIPI
TVKVLDRPGPPEGPLKVSGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVST
EVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESEPITACNPYKLPGPPSTLEASAIT
KDSMVVTWARPVDDGGAEIEGYILEKRDKEGVRWTKCNKKTLTDLRFRVTGLTEGHAYEF
RVAAENAAGVGEPSEPSVFYRACDGLYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPI
KGYVIEVKEATADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICALNSEGVGEPATIPG
SVVAQERTEPPEIELDADLRKVVILRASATLRLFVTIKGRPEPEVKWEKAEGVLTERAQI
EVTSSYTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPINLTIREVKKDS
VTVSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKNTFKIENLQEGCSYYFRVLA
ANEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEM
QTKGSEKWSTCTQVKTLEATVSGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIAKDIEIK
PSVELPFHTFNVKARDQLKIDVPFKGRPQATVSWKKDDQTLRETTRVNVSSSKTVTTLCI
KEASREDVGTYELCVSNSAGSLTVPITVIVLDKPGPPGPIHIDEVSCDNVTISWTAPEYD
GGCQISNYIVEKRETTSTTWQVVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSE
SSPVVAEYPFTPPGPPGTPKVVHATKSTMLVSWQVPVNDGGSHVIGYHLEYKERSSILWS
KANKIPIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKACEPVPARDPCDPPGQPEVT
NITRKSVSLKWSKPHYDGGAKITGYIIERRELPDGRWLKCNYTNVQETYFEVTELTEDQR
YEFRVFARNAADSVSEPSESTGPITVRDDVEAPRIMMDVKFRDVIIVKAGEVLKINADIA
GRPLPVISWAKDGVEIEERARTEIISTDYTTLLTVKDCIRRDTGQYVLTLKNVAGTRSMA
VNCKVLDRPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSRLAWTICE
AESRITSCKVTKLLKGNEYIFRVTAVNKYGVGEPLESVAVKALDPFTVPSPPTSVEVTSV
TKDSMTLCWSRPESDGGSDISGYIIERREKNALRWVRVNKKPVYDLRVKSTGLREGCEYE
YQVYAENAAGLSLPSETTPLVQAEDPVFLPSPPSKPRIVDSGKTTITIGWVKPLFDGGAP
ITGYTVEYKKSDETDWKTAIQSFRGTEYTMSGLTTGAEYVFSIRSVNKVGASDPSDSSDP
QIAKEREEEPVFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPSVSWSKPDTDLRTRAYID
STDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTFAVKVLDSPGPPASITVHEVTKESA
VLSWDVPENDGGAPVKKYHIEKREASKKAWVSVTNNCNRLSYKVTTLQEGATYYFRVSGE
NEFGIGVPAETKEGVKITEKPSPPEKLGVINVTKDSVCLTWLKPEHDGGSRIVHYVVEAL
EKGQKNWLKCAMVKSTQHVVSGLRENHEYFFRVFAENQAGLSDPRELLLPVLVKEQLEPP
EIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEVTAENLTI
NLKESVTADAGRYEITAANSSGTTKAFISIIVLDRPGPPTGPVVISDITEESVVLKWEPP
KYDGGSQVTNYIVLKRETNTAVWAEVSAMVARTVIKVMKLTTGEEYQFRIKAENRFGISD
HIDSACVVVKLPYTTPGPPSTPWVTNVTRESITVSWHEPVSNGGSAVTGYHLEMKDRNSI
LWQKANKMLIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHASEPVLAIDACEPPRNL
RITDISKNSVNLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVIETQFTVSGLTQ
NSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRA
GISGKPEPTIEWYKDDKELQTNALVCVENTTDLASILIKDANRLNSGSYELKLRNAMGSA
SATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWS
MVAENLEECIITTTKIIKGNEYVFRVRAVNKYGIGESLESEPVVAKNAFVTPGPPSVPEV
TKITKNSMTVVWSRPVADGGSEISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTEQS
DYQYRVCAINAAGMGPFSEPSDFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDG
GSAITGYIVEMRQGEEEEWNIASTKGEVRTTEYVVSSLQPGVNYYFQVSAVNCAGQGEPI
KMTEPVQAKDILEEPEIDLDVALRSSIIAKAGEDVQVLIPFKGRPSPTVTWRKDEKNLGS
DARYSIQNTDSSSLLIIPQVTRNDTGKYILTIENGVGQPKSSTVNVKVLDTPAACQKLQV
KHVSRGTVTLFWDPPLIDGGSPIINYVIEKRDATKRTWSSVSHKCSSTSFKITDLSEKTP
FFFRVLAENEMGVGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSIILSWTKPDFDGGSVI
TEYVVERKGKGEQTWSHAGISKSCEIEISQLKELSVLEFRVFAKNEKGLSDAVTIGPLTV
KELVITPEVDLSEIPGAQISVRIGHNVHLELPYKGKPKPSISWLKDSLPLKESENVRFSK
TEKKITLNIKNVKKEHGGKYTVILDNAVCRNSFPITIITLGPPSKPKGPIRFDEIKAESA
IMSWDIPDDDGGGEITCYSIEKREASQTNWKMVCSSVARTTFKVSNLVKDAEYQFRVRAE
NRYGVSEPLVSNLIVAKHEFRIPGPPGKPVVYNVTSDGMSLTWDAPVYDGGSEVTGFHVE
KKERNSILWQRVNTSPISGREYRATGLIEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSP
VDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVAYSIERRQGDDRWVRCNFTDISECQYT
VTGLSPGDRYEFRIIARNAVGTISPPSQSSGVIMTRDENVPPTVEFGPEYFDGIIIKSGE
SLRIKALVQGRPVPRVTWFKDGVEIEKRVNMEITDVLGSTSLFVRDATRDHSGLYTVEAK
NVSGTTKADIKVKVQDTPGKVVGPIRFTSITGEKMTLWWDAPLNDGCAPVTHYIIEKRET
SRLAWALIEDKCEAQSYTAIKLITGNEYQFRVSAVNKFGVGRPLDSDPVIAQIQYTVPDA
PGIPEPSNVTGNSITLTWARPESDGGNEIQHYILERREKKSTRWVKVISKRPISETRFKI
TGLIEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPSAPTVVKVTDTSKTTVSLEW
SRPVFDGGMEIIGYIIEMCKADLGDWHKVNTEACVKTRYTVTDLQAGEEYKFRVSAINGV
GKGDSCEVTGTIKAVDRLTAPELDIDASFKQTHIVRAGASIRLFIAFRGRPTPTAVWSKP
DSNLSIRADIHITDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDSPGPPGP
ITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVVSEKCTRQIFKVSDLAE
GVPYYFRVSAENEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPEHDGG
SRITGYLLEMRQKGSDFWVEAGHTKQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFS
SVIIKEPQIEPTADLTGITDQLITCKAGSPFTIDVPISGRPAPRVTWKLEEMRLKETDRV
SIITTKDRTTLSVKDSMRGDSGRYFLTLENTSGVKTFTITVVVIGRPGPVTGPIEVSSVS
AESCVLSWAEPKDDGGTEITNYIVEKRESGTTAWQLINSSVKRTQIKVTHLTKYKEYSFR
VSSENRFGVSKPLESAPIVAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKITG
YWVEKKERNTILWVKENKVPCLECNYKVSGLVEGLEYQFRTYALNAAGVSKASEASRPVM
AQNPVDAPGRPEVTDVTRSTVSLIWSAPVYDGGSKVVGYIVERKPVSEVGDGRWLKCNYT
IVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCHDEYAPPKAELDARLQG
DLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSD
SGKYTLTVKNASGIKAVSVMVKVLDSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAAISH
YIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYTFRVRAVNKYGPGVPVESEPIVAR
NSFTIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNRDYM
VYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSTPRVVDTT
KRSISLAWTKPTYDGGADIIGYVLEMKEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYS
FRVASVNEKGMSEYSETTAEIEPVERLEIPDLELADDLKKTVTIRAGASLRLMVSVSGRP
PPVITWSKKGINLANRAIIDNTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKV
YDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIIEKREAAMRAFKTVTTKCSKT
LYRISGLVEGMMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVVDVTKSTVTLA
WEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVISLNEGEQYLFRVRAQNE
KGVSEPREIVTAVTVHDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPITGRPPPTASWFF
SGSKLKESERVTVETHTKVTKLTIRETTIRDTGEYTLELKNVTGTTSDTIKVIILDKPGP
PTGPIKIDEIDATSVTISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRPTFKFT
RLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSISIPGPPETLQIFDVSRDGMTLTWYP
PDDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAINARGT
GKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKV
DQHEWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYP
DYELDERYQEGVFVRQGGVIKLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTELVI
KEADRNDSGTYDLVLENKCGKKTLYIKVKVIGSPNTPEGPLEYDDIQARSVRVSWRAPAD
DGGADILGYILERREVPKAAWYTIDSRVRSTSLVVKGLKENVEYHFRVSAENQFGISKPL
KSEEPVIPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTD
KWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQP
GELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKDRIKDRQFTIGG
LLEATEYEFRVFAENETGLSRPRRTAMSVKTKLTSGEAPGIRQEMKDVTTKLGEAAQLSC
QIVGRPLPDIKWYRFGKELVQSRKYKMSSDGRTHTLTVMTEEQEDEGIYTCIATNEVGEV
ETSSKLLLQAAPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSEN
VTIENTEHYTHLVMKNVQRKTHAGKYKVQLSNAFGTVDAILDVEIQDKPDKPTGPIVIEA
LLKNSVVISWKAPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGY
YFRVSAQNTFGISEPLEVASVVIIKSPFEKPGVPGKPIITAITKDSCVVAWKPPASDGGA
KIRNYYLEKREKKQNKWIAVTTEEIRETVFSMQNLIEGLEYEFRVKCENLGGESEWSETS
EPVTPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPVVKWYRQGKEIIADGLK
YRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLDVEVPAKIHLPKNLEGM
GAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFSNGVERK
DAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKIT
NYIVEKCATTAERWIRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTIT
KEDKTRALNYDEEVDETREVSMTKASHSKTKELYDKYMIAEDLGRGEFGIVHRCVETSSK
KTFMAKFVKVKGTDQVLVKKEISILNIARHRNILYLHESFESMEELVMIFEFISGLDIFE
RINTSAFELNEREIVSYVRQVCEALEFLHSHSIGHFDIRPENIIYQTRRSSIIKIIEFGQ
ARQLKPGDNFRLLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQ
IIENIMNAEYTFDEEAFKEISFEAMDFVDRLLVKERKSRMTASEALQHPWLKQKIENVST
KVIRTLKHRRYYHTLIKKDLNMVVSAARISCGGAIRSQRGVNVAKVKVAPIEIGPISGQI
MHAIGEEGGYVKYVCKIENYDQATQVTWYFGVRQLENSEKYEITYEDGVATMYIKDITRF
DDGTYRCKVVNDYGEDSSYVELLVKGVREVYDYYCRRSVKKIKRRTDTMRLLERPPEFTL
PLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPDEDDKKYTFESDKGLYQLTINS
VTADDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTETTLRPMFKRLLANAECQEGQSICF
EIRVSGIPPPTLKWEKDGQPLSLGPHIEIVHEGLDYYALHIRDTFPEDTGYYRVTATNTA
GSTSCQAHLQVERLRYVKQEFESKEERERHVQKQIEKTLRMAEILSGTESVSLTKVAQEA
LREAAILYKPAVSTKTVKGEYRLETEEKKEERKFRMPYEVPEPRKYQQATVEEDQRIKQF
VPMSDMKWYKKIRDQFEMPGKLDRIVQKRPKRIRLSRWEQFYVMPLPRITDQYRPKWRIP
KLSQDDLEMVRPARRRTPSPDYYFYYRPRRRSLGDMSDEELLLPIDDYLAMKRTEEERLC
LEEELELGFSASPPSRSPPRFELSSLRYSSPQAHIKVEEKRKDFRYSTYHVPVKEETRTS
YAELRERHAQASYRQPKQRQRIMAEKEDEELLRPVTTTQRLSEYRNELDHMSKEEKSKKK
SKRQRKVMEITEIEEEYEISRRAKRESSSSVSRLLRRRRSLSPTYIELMRPVSELIRSRP
QPAEEYEDDLERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQK
TSERKYEVLSQQPFTLDHAPRITLRMRSHRVPSGQNTRFILNVQSKPTAEVKWYHNGVEL
QESSKIHYTNTSGVLTLEILDCHREDSGTYRAICTNYKGEASDYATLDVTGGDYITYASQ
RRDEEVPRSVFPELTKTEAYAVSSFKKTSEMEASSSVREMKSEMTETRESLSSYEHHASA
EMKSTALEEKSVEEKSTTRKIKTTLAARILTKPRSITVYEGESARFSCDTDGEPVPTVTW
LRGGQVISTSTHHQVTTTKYKSTFEISSAQASDEGNYSVVVKNSEGTQEAQFTLTVQKAR
VTEKAVTSPPRVKSPEPRVKSPEAAKSPKRVKSPEPVTSSKAVSPTETKPTPIEKAQQLP
ASGPPKISQSLKAEASKDVAKLTCAVESSVLCAKEVTWYKDGKKLKENGHFQFHYSADGT
YELKIHNLTESDCGEYVCEVSGEGGTSKTSFQFKGQAFKSVHEQVSSISETKKSAQKTAE
STETKKSAQKSGEPIETKKTEPKAPEPISSKPVIVTGLQDTTISSDSIAKFTVKATGEPQ
PTVTWAKDGKAITQGGKYKLSEDKGGFLLEIQKTDTSDGGLYTCTVTNSAGSVSSSCKLT
IKAAKDSKTQKVSTQKTSEIAAQKAAVQEEISQKALISEEVKISEVKSQDKLALKEEVKK
SAATSLEKSIIQEEVTKSSQALEEVRTQAEIKAFSSQMSITDGQKVTLKANIAGATDVKW
VLNGLELANSEEYRYGVSGSDQTLTIKQASHRDQGVLTCIGKTSQGVVKCQYDLTLSKEL
SDAPAFISQPRSQNINEGQNVLFSCEISGEPSPEIEWFKNNLPISVSSNISVSRSRNIYT
LEIRNASVSDSGKYTVKAKNFRGQCSATASLTVLPLVEEPSKEVVLRTRGDTSLQGSFSS
QSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGKSSMT
QLESSTSRMIKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEITWSCGGRKIE
NQDQQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNINIRSM
NT seq 102765 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcaagcgccgacgtttacgcagccgttacaaagtgttgtggtactggagggt
agtaccgcaacctttgaggctcacattagtggtttcccagttcctgaggtgagctggttt
cgggatggccaggtgatttctacttccactctgcccggcgtgcagatctcctttagcgat
ggccgcgctagactgatgatccccgccgtgactaaagccaacagtggacgttactccctg
agagccaccaatggatctggacaagcgactagcactgctgagcttctcgtgacagcagaa
acagcaccacccaacttcactcaacgactgcagagcatgacagtgagacaggggagccaa
gtgagactccaagtgagagtgactggaatccctacacctgtggtgaagttctaccgggac
ggagctgaaatccagagctcccttgattttcaaatttcacaagaaggcgacctctacagc
ttactgattgctgaagcataccctgaagactctggaacctattcagtaaatgctactaat
agcgtgggaagagctacttcgactgccgaattgctggttcaaggtgaagaagtagtaccc
gcgaaaaagacaaagacaattgtttcgactgctcagatttcggaaacaagacaaaccaga
attgaaaagaagattgaagcccactttgatgccagatcaatcgcaacagttgaaatggtc
atagatgaggccactggacagcagctgccgcataaagctcctcccaggatcccccctaag
ccaaagtcgaggtctccaacgcctccgtccctcactaccaaggcacagctggctcgacag
cagtccccgtcccccgtcagacactccccgacccccgtcagacacgtgagggccccgacc
ccgtctcctgtcaggtctgtgtctccagctgggaggatctctacatcccccataagatcg
gttaagtcaccattactcatccggaagacgcaggcagccaccatggccacaggccctgaa
gtacctcccccttggaagcaagagggctacgtggcctcctccactgaggctgagatgagg
gagacgagagtgatgagctctactcagatcaggagagaagagcgctgggaagggagattt
ggtgtccaggagcaggtgaccatcaccggggctgcaggcgctgccgccagcgtggccgcc
agcgcacactttgcggcaggagctgtcaccgctggtgctaaggaggtgaaacaagaggca
gacaagagtgcagctgttgcaactgttgttgctgctgttgatatggccagagtgagagaa
ccagttatcagcgctgtagagcagactgctcagaggacaaccaccacgactgccgtgcga
gtccaacctgctcaagaacaggtgagaaaggaggcggagaaaactgccataactaaggta
gcagtggccgccgataaaaccaaggagcaagaagtaagaaccagagaagtaattacaacg
aaacaagagcagacacatgcaactcatgaacagataagaaaggaaaccgaaaaagcattt
ataccaaaggtagtaatttctgcaactaaagccaaagaaaaagaaactagaattactgga
gaaattactacaaaacaagaacaaaagcagataactcaagaaacactaaggatggaagct
gagaaaatgtccatatctaagttaatagttaacactgcagaggcagctgaaccagtcaca
ctgccaaggactacagaaggatttgctgttaagcaagaaccgatacatctttttcaaaag
gagatgaaaactcatgctgcagaggtgggcgctgggaaaaaagctgaagctgtagcaaca
gtggttgccgcagtagaccaggcccgtgtaagagagccccgagaacccgggcacctggaa
gaatcctatgctcagcagaccactttggagtatggatataaagaacacgtttccaccaca
aaggtgcctgagcatccccagcgtccagcctcggaaccccaagttgtccctaaagcagtc
aagcctgtggtgattcaggctccttctgagacttacgtcaaaactactgatcaaatggga
atgcacatatcatcacagatcaagaaaactacagatctaacaacagaaagattagtccat
gtggataaacgcccccgcacggccagtcctcactttaccgtttcgaaaattactgttcca
aagacagaacatggatatgaggcatcgctagctggcagtgctattgccacattacaaaag
gagctgtcagtcacgtctgctcagaagatcaccaagtcggtgaaagctcctaccgtgaag
cccggtgagaccagagtcaggccagagcccaccccttcgccacagttccccttcgctgac
atgccagacacttacaagagtcaagctggcattgaagtgagaaaggaagtaggggtgagc
atcactggcactacagtccgtgaagagcgcttgaaagtcctgcacggacgtgaggccaag
gtaacagaaacagcaagagtgcctgcacctgttgagattcctgttactccaccaacttta
gtctcgggcttaaaaaatgtaactgtcatagaaggtgaatctgtcaccttggagtgccac
atctctggatacccgtcccccaaagtgacatggtacagagaggactaccaaatcgaaagt
tccattgacttccagataaccttccagggtggaatcgctcgccttatgatccgcgaagcc
ttcgcggaggacagtgggcggttcacttgcagtgctgtgaatgaggctggaaccgttagc
acatcctgctatctggctgtacaggtgtcagaagagtttgacaaggaaacaactgtggct
gagaaatacactgcagaagagaaacgctttgtcgagtcaagagatgtggtcatgatggat
accagcatcactgaggaacaagcagggcctggagaacctactgcacctttcttcattaca
aaaccagtggtgcagaagctagtggaaggcgggagtgttgtgtttgaatgccaggttggc
ggcaacccgaagccccatgtctactggaaaaaatccggtgttcctctcaccactggatac
agatacaaagtaagttacaacaaacaaactggtgaatgcagactggtgatttctatgact
tttgctgatgatgctggagagtacactattgttattcgtaataagcacggagaaatttct
gcgtctgcttccttgcttgaagaagctgattacgagtcactcgtgaggtcccagcaagaa
atgctttaccagacacaaacaactgcgtttgttcaagaacctaaagtgggagaaatagca
cctggattcatatattctgattatgaaaaagaatatgaaaaagaacaggccttaattagg
aagaaaatggccaaagatactgtaatggtcagaacttttgtagaagaccaggaattccat
atttcttcctttgaagagaggcttattaaagaaattgaatacagaataataaaaactaca
ttagaagaacttcttgaagaagacagagaagaaaagatggcagttgacatttctgaatct
gaggctgttgagtcaggatttgatttgagaatcaagaattatagaattcttgaggggatg
ggtgtcacttttcattgcaagatgtctggatatccattacccaagattgcatggtacaaa
gatggcaaacgcatcaaacatggagaaagataccaaatggactttctacaagatggcaga
gctagtctgcgtatacctgttgttcttcctgaagatgaaggaatctatactgcatttgcc
agcaatattaaaggaaatgcaatttgctcagggaaattgtatgtggagcctgctgcacca
cttggagttccaacttacatacccacaccagaaccagtgagcagaatcaggtctgtatct
ccacgttcagtgagcaggtctcctatacgaatgtcccctgcacggatgtcccctgcacgg
atgtcccctgcacggatgtcccctggtcgtaggctggaggaaacagatgaatcacaactt
gagaggctgtataaaccagtctttgtgttaaaacctgctcctttcaaatgtttagaagga
caaactgccagatttgacttaaaggttgtgggtagacctatgccagagacattctggttt
cacaatggccagcaaattgtcaatgattatacccataaagtagtcattaaagaagatggc
acccaatcactgattattgtcccggcaacacccagtgactctggagagtggactgtggtt
gcccaaaacagggcaggcaaatcttcaatttcagtgacattaaccgtagaagctgcggag
catcagataaaaccagcatttgtggaaaaactaaaaaatgtcaacataaaggaaggttcc
cgacttgaaatgaaagtcagagccatgggtaaccctaatcctgacattgtgtggttaaaa
aacagtgacatcattgtacctcataaatatccaagaatcaggattgaaggaaccaagggg
gaagcttttcttaaaattgattccactgccagccaagattctgcctggtacactgcgact
gctattaataaggctggccgagacaccacaaggtgcaaagtcaatgttgaagtggagttt
gcagagcctgaaccagagagaaggttaatcatcccacgaggaacatatagagcaaaggag
attgcagcccctgaactggagcctctccatttgcggtatggtcaagaacaatgggaagaa
ggtgacctctatgacaaagagaaacaacagaaaccgtttttcaagaaaaaactcacttcc
ttaagactgaagcgctttgggcctgctcactttgagtgtaggctcacacctattggtgac
ccaacgatggtagtggaatggctccatgatggaaagccactggaagcagccaacaggctc
cgaatgatcaatgagtttggctactgcagcctcgactatggagttgcatactctagggat
agcggtatcattacttgcagagccactaacaaatacggaacagatcatacatctgctacc
cttattgtcaaagatgaaaaaagtcttgtggaagaatctcaattgcctgagggaaggaag
ggcttacagagaattgaagaattagagagaatggctcatgaaggtgcacttacaggtgta
acaacagatcagaaagaaaagcaaaagccagacattgttttgtttccagagccagtaaga
gtgctggaaggcgagacagcaagattccgctgccgagtaacaggctaccctcagcccaag
gtcaactggtatctcaatggtcagctcatccgcaaaagcaaaaggttcagagtccgctat
gatggcatccattatctggacattgtggactgcaaatcttacgatacaggggaagtcaag
gtcaccgcagaaaaccctgaaggtgtgacagagcataaagtgaaacttgagattgaacag
agggaagatttcaggtctgtccttcggcgagctccagagccaaagcctgagtttcacgta
cacgaaccaggaaaacttcagttcgaagtgcaaaaggtagataaacctgttgacaccacc
gaaaccaaagaaattgtgaagctgaaaagggctgagagaattacacacgaaaaagtgtct
gaagagtccgaagagctgcgtagtaaattcaaacgcagaacagaagagggctattatgag
gccatcaccgctgtggagctcaagtcccggaagaaagacgagtcctatgaagaactcctg
aggaagacaaaagatgaacttcttcactggaccaaagagctaactgaagaagaaaagaag
gcccttgctgaagaaggcaaaatcactattccgacttttaaacctgacaaaattgaactt
agtcctagtatggaggcacccaaaatctttgaaagaatccaaagccaaacagtaggccta
ggatctgatgcacacttcagagtcagagtggtggggaaaccagaccccgaatgtgaatgg
tacaaaaatggtgtcaaaatcgagcggtctgaccgaatctactggtactggccagaagat
aatgtttgtgaattggtcataagagatgtgacagctgaggactcctctagcatcatggta
aaagccatcaatatagctggggaaacctcgagtcatgcgttcttacttgtccaagccaag
caattgatcacttttacacaagcattacaagatgttgttgctaaggaaaaagacaccatg
gcaacatttgaatgtgaaacttcagagccatttgtcaaagtgaaatggtataaagatggg
atcgaaatttatacggggaataaatatagaatgcactctgacagaaaggtccacttcctc
tctgtactgaccattgactcatctgatgctgaagactatagctgtgtgcttgtggaagat
gaaaatatcaaaacaacagctaaacttattgttgaaggtgctgttgttgagtttgtgaaa
gaacttcaggacatagaagttccagaatcattttctggagagttacagtgtattgtatcc
ccagaaaatatagaaggcaaatggtatcataataacgtggagcttaaatctaatggcaaa
tactcaattacatctcgccgtggacgtcaaaatcttacagtcaaagatgtaacaaaagaa
gatcagggagaatacagcttcgttgtcgatgggaaaaagacaacttgtaaacttaagatg
aaaccccgacccattgctattctacaaggacttagtgaccaaaaagtctgtgaaggtgac
attgtccagctcgaagttaaagtctccttagaaaatgtggaaggcgtctggatgaaagat
ggccaagaagtacagcatggtgacagggttcacattgttatagacaaacagtcccatatg
ctgctcattgaagacatggccaaggaagatgctggaatctactccttcaccatcccagcc
cttggtctctccaccagtgggcacgtctctgtctacagtgtgggtgtgataacccctctg
aaagatatcaatgtgattgagggtaccaaggctgtacttgaatgtaaggtctcagtcccc
gatgtgacttctgttaaatggtacctaaacgatgaacaagtcaagcctgatgaccgcgta
caagccattgtcaaaggcactaagcagagactcgtgattaaccgaacttatgcttcagac
gaaggtccttacaaactgatggtcggcagagttgaaactagctgtaatctctctgtggag
aaaattaaaattatcagaggtcttcgggacatgacctgtacagaaacccaaaatgtggtc
tttgaggttgaactgtcccactcaggaattgatgtcttatggaattttaaggacaaagaa
atcaaacccagtgctaaatataaaattgaagcccatgggaaaatatataaattgacagtt
ctaaatatgatgaaagatgatgaaggagaatatacattttatgctggagaaaatatgaca
tctgggaaacttacagtgtcaggcggtgccatctccaagccactcgtagatcagactgtg
gctgaatcccaggaagctgtgtttgaatgtgaagttgccaacccagattctgaaggtgaa
tggttgaaggatggcaaacacctcccactgagcaacaacctcagaagtgaatccgatggc
cacaaaaggagacttatcattgctgccaccaaattagatgacgttggagaatacacctac
aaggtggccacttccaaaacatccgccaaactcagagttgaagcggtcaaaattaagaag
actctgaagaacctcacagtgacagagacacaggatgctatttttactatcgagcttaca
caccctaacgtcagaggtgtccagtggatcaaaaatggggttgtgctggaatccaatgac
aagtatgatatctcagtcaaaggaacaacttactctctgaaaattaaaaactgtgccatt
gtggatgagtctgtctatggattcagacttggaaggctgggagccagtgccaggctacat
gttgagactgtcaagatcatcaagaagccaaaggatgtgactgccttagaaaatgccacc
attgccttcgaagtcagtgtttcccatgacacagttcccgtcaaatggttccataggaat
gtggagattaagccaagtgataagcacagactggtctctgagaggaaggtccacaagctg
ctactgcagaacatttctccctcagatgccggggaatacacagctttggtggggcaactg
gagtgcaaagcaaagctgtttgtggagacattacatattacaaaaactatgaaaagtatc
gaggtacccgagaccaaaactgcctccttcgaatgtgaagtgtcccatttcaatgtgcca
tccatgtggctgaagaatggagtggaaatcgagatgagtgaaaagttcaaaatagtcgtg
caaggaaaactccaccagctgataatcatgaacactagctcagaggactcagcagaatac
acatttgtctgtggcaatgaccaagtcagtgccaccttgacagttaccccaatcatgatt
acatccatgctgaaggacatcaatgctgaagaaaaagacactattacttttgaggtgaca
gtaaattatgaaggcgtctcttacaaatggttaaagaatggtgtggaaatcaagtcaact
gacaagtgtcagatgagaaccaaaaagctcacacactacttaaacatcaggaatgttcac
tttggagatgctgctgactatacctttgtggctggaaaagctacatcaacagccaccctt
tatgtggaagctcgccatatagaatttagaaaacacatcaaagacattaaggttctcgag
aagaagcgagcaatgtttgaatgtgaagtttctgagcctgacataactgtccagtggatg
aaagatggccaagaactgcagattgcagacaggatgaagattcagaaagagaaatacgtt
caccgccttctgattccatccactcggatgtcagatgccgggaagtatacggtggtagca
ggaggcaacatgtcgagtgctaccctctttgtagagggcagagatgtccgcattcgaagt
attaaaaaggaggttcaggtcattgagaaacagcgtgctgtcgttgagtttgaggtcaat
gaagacgatgttgatgcccattggtataaagatggcattgaaatcaatttccaagttcaa
gaacgataccagtatgtggtggagagaagaatccacaggatgttcatctctgagactaga
cacagcgatgcaggcgaatacacctttgtggcaggaaggaacagaagttccgtgacactt
tatgtcaatgctcctgaaccaccccaaatcctacaggagctccagcccactactgttcag
tctggcaagcctgctcgcttctgtgctgtgatatctggcagaccacagcccaaaatttcc
tggtacaaggaggagcagctgctttccactggcttcaagtgcaaatttcttcacgatggg
caagagtacacgcttttgctaattgaagccttcccagaggatgcagctgtctacacctgt
gaagccaagaatgactatggagttgccacaacctcagcttcactttcagtggaagttcca
gaagttgtgtctcctgatcaggaaatgccagtttatcctcctaccattatcactccactt
caagacactgtcacttctgagggacagccggcccgttttcaatgcagagtttctggaaca
gatctaaaagtatcttggtacagcaaagacaagaaaatcaagccatcgcggttctttaaa
atgacacagtttgaagacacttaccaattagaagttgctgaagcttatccagaagatgaa
ggaacttacacttttgttgctagtaatgctgtaggccaagtgtcaagcacagcaaacttg
agactggaagcccctgaatcgatgctgtatgaggggattgaacagcaggttgaaatggag
atgaaagcgttttctagttttctctctgctgaggaagaacttcagtcctatagttccgac
ctacagttatctaatacaaacgaaacacttgaacttttgtctgaacctccagttcattca
agtgaatttgattccaaaaatgctggcagtgccccaattttcaccagagaggtgtcaaat
gctgagattagcatgggggatgtggctaagctgtctgtcactgccactgccattcccaag
cctaaaattcaatggttctttaacggagtaatattaaccccttctgctgactacaaattt
gtttttgatggtgacgatcatagcctgatcattctgttcaccaaattggaggatgaggga
gagtacacatgtatggctagtaatgaatatggaaaaacaacatgtagtgcttatctaaag
atccatcccaaaggagagggacacaaagagacagaaacagaagcaacagtggagacatct
ctggaaaagcttgaagggccttgtcctccttacttcctcaaggagttaaaaccagtccgc
tgtgctcctgggctccctgctgtctttgagtacaaggtgtatggagaccctgcccccact
gttttgtggttcaaagaaaacaagcagctttgcaccaatgtttattacaccatcattggt
aatcctgatggctctgggacgttcattgtcaatgacccgcaggtgaaagacagaggcctc
tatgtctgcaaagctgagaacgtgtggggtgagtccacctgtgctgcagaactgcgtgtg
cttctggaggacccagacatgactgacgccccctgcagagcagagtccacatcagaagct
cctgacaacatcccagaaatgttgctacagagcagtgcagaagaggcattcaactcaaag
caggaaatcacagtttttataaaggacaccattttgaaagctgctttaattgcagaagaa
atgcagcagatttcttatgatcatactgttaaaaccaatggactgagcagtgaagctact
ttagaggctgagcaattgcgatccatggtcatgttggaggaggacatgcccattcccgca
agcaccagagaacttcctcctagggacagtactatgcatgtgcagcctagtaaggagcca
cctcccaaattacagctgcaaattgtccagtcccagaaaaccctcgctaaagaggataca
ctattgtttcaagagcctgaaaaaatcttcccaagtgtttcctccatagaacagattagc
tcagtaacagtggagcctctgacaaccttaacagctgggcctgaaagaagttacccacag
ccttcagcagaacctccagcacattcgcatccatcctttgtggctgaagaagtactttta
ctaaaagaacagactgtgtctgaagtgggcaaagggcaaagagtgactcttcaaaagcaa
gaagcacaaagtgctctcatcctgagccagagtttagctgaggggcacccagaaagtttc
caggctcctgagatcctgacctctaacatcacctctgagccccaggtcccttcagaacac
acatgcacagaagatggcaaaatcctgatggagagtgtggatcagttagaaaatgtaggg
cacaattttgggatcaggattgaggaaggcaaatccttaagatttccactggcactcgag
gaaaagcaagtcctgttcaaggaagaacatgctgatgacactgcaacacccacaacccag
accactgagtatgcaaaagagcccgtggtgatgaagggagtacaagaggtgcagggaagt
gacattctttctaaggaaaatttgcttcccagtattccagaagagcaaggattaaacctg
aaagctcagatacgcagggctttgcaagctgcggtggccagtgagcagccaggtcttttc
tctgagtggttaagaaacattgaaacagtggaggtcaaggccataacctttacccaggag
cccaaacgcatcatgtgcacctaccttattacttcactgaaggctctaacagaagaagta
accattgctattgaggggattgatcctcaaacagctaacttgaaaactgaacttaaggat
gctttgtgctgtattgtgtgtgaggaaataaacatcttaacagcagaggaacccagaatg
cagaaaggaagcacaataaatatgcatgaagaagtggattctttttcagagtcacagaag
gttgaagcaatcactgaaccccaagttaaatctaaataccttgtctccatgcaagaggtc
agttgttctactgtggagagtcaggttaaagatacagataccacagctgccactgaggag
gttgtgccagctgccctctctaaacaggcacagcatgagactctgaaaccaccagaggaa
aaagagaaaccttccgaaagtggtgaaagtggtaccaaggagactcgtagagtagaaata
caagaagtcaagcatagcataattaaagaggatcctcctgttatacacacacccttagtg
gacaccgtttctgaggaaggtgatgttgtatacctcacttcatccataacaaatgctaaa
gaagtgaattggcattttgagggaaaactggtgctttcagatcaaaagttcaagtgtttt
caagatgaaaatacatatacgctcataatcgacacagtaaatgcagaagatcaccaagga
gagtatgtttgtgaggcttccaatgacaacggaaaaacaacaacttcagcaaaactcact
gtaataaaaagagctgccccggtgatcaggaggagaattgagcccctggaagtagctctg
ggccacctagctaaattcacctgtgagatccatagtgctcccaatgtccggttccagtgg
ttcaaagcgggcaaagaaatttatgagagtgacaagtgttctattcgatctgcaaattat
gtctccagcctggaaatcctgagaacccaggttgttgactgcggggagtacacgtgcaaa
gcttccaatgagtatggcagtgtcagctgtacagccacactaactgtgacagaggcatat
ccaccagcatttgtctccagacctaagtcccttacgactttcgtgggtaaggcagtcaag
ttcctctgcacagtgtcagggactccggtgatcgaaaccatttggcagaaagacagtgct
gccctgtcaccttcacctaactgcaagatttcacaggcagaaaacaaacacgggttagaa
ctctcaaacctcaccgttcaggaccgaggcatttactcttgcaaagcttctaacaagttc
ggagcagacacctgccaagcggagctgatcgtcatcgacaaaccacattttattaaacag
ttagagccagtacagtcagccatcaataagaaagtccgcctggagtgccaagtggatgaa
gacaggaaagtcaccatcgcatggatcaaggatgggcaaaaactgcccccagggaaagat
tataagatctattttgaagataaaatagcatcacttgagattccactggccaaactgaaa
gattctggaacctatgtctgcacagcttccaatgaggctgggggcagctcctcttcggcg
acggtcaccatcagagagcccccgtcctttgtgaagaaggtggatccctcttacttaatg
ctcccaggagaatctgcacgcctccattgcaagctgaaaggctcacctgtgatccaggtg
acctggtttaaaaataacaaggaactcagtgaaagtaacacagtccgaatgtcttttttt
aataattctgaggccgttctcgacattatggatgtcaaagtcgaagacagcgggagttac
tcctgtgaagccatgaatgacgttggcagcgacagctgcagcaccgaaatagttatcaaa
gaacctccttctttcatcagaacccttgagcctgcagacatagtgagaggaacaaatgcc
ttgcttcaatgtgaaatcgcaggcacaggaccctttgaaattagctggttcaaagataag
aagcaaattcgaagtagtaagaaatacaggttgttttctcagaagtctgttgtgtccctg
gaaatcttttctttcaatagtgcagatgttggtgaatatgaatgtgttgttgctaatgaa
gtcgggaagtgtggctgcagtgcaacacacttattaaaagaaccaccaacctttgtcaag
aaagtagatgattttactgccttagctggacaaactgttactttacaagctgcggtgaga
ggttcagaacccatatctgtcacatggatgaaaggacaagaggtcattagagaagatgga
aaaatcaaaatgagcttttccaatggtgtggcagtcttaacaatccctgatgttcagatt
agttttggtgacaaatacgtgtgccgggctgaaaatgaagctgggagccaaacatctgtt
ggagaactgatagtgaaagaacctgccaaaattgttgagcgagcagagctgatccaggtg
acagcaggggacccagccacgctcgagtacacagtggcaggcaccccggaactcaagccc
aagtggtacaaagatgggagacctttggttgcaagtaagaagtaccgaataagttttaaa
aacaacattgcccagctcaaattctattcagctgaactacatgacagtggccagtacaca
tttgagatttctaatgaagtgggcagcagttcctgtgagacgacattcactgtgttggat
cgagatattgctccatttttcaccaaacccttacgcaacgtggatagtgttgttagtggc
acctgcagactggactgcaaaatcgctgggtccctccccatgagggtgtcctggtttaag
gatgggaaagaaatatcctcttctgacagatacagaatagcatttgtggaaggcacagcc
tccttggagatcagcagagtagacatgagtgacgcgggaaatttcacctgtcgagccaca
aattctgtgggaagcaaagacagcagcggagccctgattgtgcaagaaccacccagtttt
gtaactaaaccgggatccagggatgttctacccagctcagcagtctgcctgaagagcact
ttccaaggctctactcccttcaccatcaagtggtttaaaggtgacaaagagctggtttcc
ggtggaagctgctacattaccaaagaagcttcagagagttccctggaactctatgccgta
aaaacctccgattcaggcacctacacatgcaaaataagcaatgtcgctggaagcgtggag
tgcagtgcaaacttgtttgtgaaagaacctgccacatttattgaaaagttagagccatca
cacctattaaagaagggagctgccacccagctagcctgcaaagtaactggcactcctcca
attaaaataacatggttcgcaaatgatagagaaattaaggagagcagcaaacacagaatg
tcttttgtggagtccactgcagttctaagtcttacagacgttgccgttgaggacagtgga
gaatacatgtgtgaagctcaaaatgaggctggcagtgaccactgcagtagcgttataata
gtcaaagagtcaccctactttactcaggaatttaaaccaattgaagtgctgaaggaatac
gatgtcgtgttgctggccgaggtggcaggcacgcctccatttgagatcacttggtttaaa
gacaacacaaccttgagaagtggtaggaaatataaaaccttcatgcaggatcagctggtt
agcctgcagatcctcaagtttgtagctacagatgctggtgaataccagtgtcgggtgacc
aatgaggtgggcagcagcacctgcagtgccaaggtgactttaagagaacctccttccttt
gtaaagaagatcgagagcaccagctcgctccgaggaggcacagctgccttccaggccact
ctgaaaggctctttgccaatcacagtgacatggttaaaagacaatgaagaaatcactgaa
gatgacaatatcagaatgacctttgaaaacaatgtggccagtctgtacctcagtggcatt
gaagtcaagcatgatgggaaatacatctgtcaagccaaaaatgatgcaggcatacaaaga
tgttctgcagtactctcagtaaaagaacctgcaacaatcattgaagaggctgtgtccata
gatgtcacccaaggagacccagccactttgcaagttaaattttcagggactaaggatatc
acagccaaatggtttaaagatggccaagagctgactctgggtccaaagtataagatcagt
gtcactgacacagtctcaatcctgaagattgtttctacagaaaagaaagatagtggagaa
tatacatttgaggtccaaaatgacgttggaagaagcagctgcaaggccagaattaatgtc
ctagatcttatcatacctccttcattcaccaaaaagctgaagaaaatggatagcattaaa
gggtcttttattgacttggaatgcatagtggctgggtcacatcctataagcatccagtgg
ttcaaagatgaccgagaaatatcagctagtgacaagtacaaattctcttttcacgacaat
actgccttcttagaaatcagccagctggaaggtacagacagtgggacatacacttgttct
gccaccaacaaggcaggacacaaccagtgcagtggccatctgacagtcaaagaaccccct
tacttcatggaaaagccacagtcacaagatgtcaaccccaagacaagggttcaattaaaa
gctcttgtgggtggcactgcacccatgacaataaagtggtttaaggataacaaagagttg
cattctggggcagctcgctcggtgtggaaggatgacacctccaccattctagagctcttc
tcagccaaagctgccgactccgggacctacatttgccagctgagcaatgatgttggcata
gccaccagcaaaaccactctttttgtcaaagaaccacctcaatttattaagaagcctagt
cctgtattagtgctgaggaatggacagtcaaccacctttgaatgccaaataacaggcacc
cctgagatcagagtttcttggtatctggatggaaatgaagtaacagacattcgaaaacat
ggcatttccttcgtggatggttcagccactttccagatctctggtgccagggtagaaaat
agtgggacttacgtctgtgaagctcgaaatgacgcgggcacggcaagctgcagcattgaa
ttaaaagtgaaagaacctcccagctttctcagggagctgaagcctgtggaagtagtgaaa
gagagtgacgtagagctggagtgtgaagttacaggaacatctccatttgaagtcacttgg
ctgaaggataacaaggaaattcgaagtggcaaaaagtatacactgagtgacagagtatcg
gtgtttagcctccatataaccaagtgtgacccttcagacactggtgaatatcagtgcatt
gtggccaacgaaggaggcagctgctcctgcaatgctagagtttccctgaaagaaccacca
tcgttcatcaagaagatagaaaatgtcaccactgtcttgaagagttctgccacctttcag
agtgctgtggcaggctcgccccccatttctataagttggctgaaggatgatcagattctt
gatgaagatgacaacgtccgtgtctcatttgtgaacaacgtagccacactgcaagtcaga
agtgtggacagtggacgcagtgggagatacacgtgtcaagccaaaaatgagtcgggagtg
gagaggtgttttgctttcctcttagtgcaagaacctgctcaaattatagagaaagctaag
tcggttgatgtcaccgagaaagatccagtgaccttggagtgtgttgtgggtggaactcca
gaactcaaagtgaaatggcttaaagatggcaaacaaattgtacccagtcgatatttttca
atgagttttgaaaataatgtggctagtttcaggattcagtcagtaatgaagcaagacagt
ggtcagtatactttcaaggtggaaaatgactttggaagcagcagctgtgatgcctacctg
agagtgttagatgaaaatattcctccatcattcatcaaaaaattaactaaaatggataaa
atgctgggctcttctattcatatggagtgcaaagtttctgggtctcttcctatcagtgct
cagtggttcaaagatggaaaagaaatctctacaagtgcaaaatacaggcttgtgtgtcat
gagaacactgtgtctctggaagttaataatttggaattagaagataccgcaaactacaca
tgcaaggtgtcaaatgtagcaggagatgatgcctgcagtggcatcctgactgtgaaagaa
ccaccaagcttcctagtgaaacctgaccgccaacaagctgtacctgattctacagtggaa
tttaaggcagtgctcaaaggaacaccaccatttaaaataaagtggtttaaggaggatgtg
gaacttgtctctggacctaaatgtttcattggcttggaagggtcaactagcttcttaaat
ctctactcagtggatgcttccaagactggacaatatacttgccaagttaccaacgatgtt
ggtagcgactcttgtactacaatgttgcttgtgacagaaccacccaagtttgtgaagaaa
ctagaagcatccaaggtagtgaaagcaggtgactccacacgacttgaatgcaagataatt
ggatctccagaaatcagagttgtgtggtacagaaatgaacatgaactcccagtcagtgat
aaataccgaatgactttcatcgattctgtggctgtcctgcagatgaacaatcttggtact
gaggacagtggagatttcatttgtgaggctcagaatcctgctggcagcacaagctgcagt
accaaggttatagtaaaagaaccacctgtttttagcagcttccctcctgtagtagaaacc
cttaaaaatactgaagttagtcttgaatgtgaactttcgggaacaccaccatttgaggtg
gtatggtacaaagacaagcggcaactcagaagcagcaagaaatacaagattgcatctaaa
aacttccatgcaagtattcatattctcaatgtggaatcttcagacatcggcgaataccac
tgtaaagcacagaatgaagtgggaagtgatacttgcatttgtactataaagttgaaagaa
cctccaagatttgtttccaaactgaacagcctcactgttgtagctggcgaacccgctgaa
ttacaagcatccattgaaggtgcccagccaatttctgtccagtggcttaaagagaaagaa
gtgattagagagagtgaaaacatcagaattacatttgtggaaaatgttgtgactctgcag
tttgcaaaagcagagccagctaatgctgggaagtatatctgccaaatcaagaatgacggt
ggaattagggagaacatggccacactgacggtcttagagcctgcagtcattgttgagaag
gcaggaccgatgacagtgactgtaggagaaacatgcaccctggagtgtaaggtggccggc
actcccgagctgtctgttgaatggtacaaggacggaaagctgttgaccagcagccaaaag
cataaatttagtttttacaacaaaatctcttccttaaagattgtctccattgaaaggcaa
gatgcgggcacttacacttttcaggttcaaaacaatgtgggaaagagcagctgcatggct
gtggttgatgtttcagaccgaatggttcctccctctttcacacgaagactgagagatacc
ggtggggtcctgggtacctcttgcattttggaatgcaaagtagctgggtcatcccctatc
tctgttgcctggtttcatgagaaaacaaagattgtcagtggagcaaaataccaaaccaca
ttctcagataatgtctgcacactgcagttgaattctctggactcatcagatatgggcaat
tacacctgtgtggctgctaatgtcgctgggtccgatgaatgtcgtgcattgttgactgta
caagaaccaccctcttttgtaaaagaacctgaacctttggaagtactgccaggcaaaaat
gtaaccttcacaagtgttatcagaggaacccctccattcaaggtgggctggttcagagga
gccagagaactggtgaaaggagacaggtgcaacatctattttgaagacaccgtggcggag
ctggagttgtttaacattgacatatctcagagtggggaatatacgtgtgtggtttctaac
aatgctggccaaacctcctgtactacacgtctctttgtaaaagaaccagctgtatttgtg
aagaaattaagcgatcactctgtagaaccagggaggtccataattctggagggcacctac
agtggaacgctgcctatttcagtcacctggaaaaaggatggtttcaacataactccatct
gagagatgcagcatagtcacaacagagaaaacgtgcatcctggaaattttgaatagcaca
aaaagagatgcaggacactattcctgtgagattgaaaatgaggcaggaagggatgtctgt
gatgctctcatatctacattagaaccaccttattttgttacggaactggaacctctggag
gcagcagttggagatacagtttctttgcaatgccaagttgcggggacaccggaaattaca
gtgtcctggtacaaaggagacaccaaattacggtcaactcctgaatacaggacctacttt
acaaacaatgtggccacacttgtttttaataaagtagacatcaatgacagtggagagtac
acctgtatagcagaaaatagtataggaactgcttcttccaagactgtctttagaattcaa
gagcgccagctcccaccttcttttgcaagacaactaaaggacatcgaacaaaccgttggg
ttacctgttacactcacgtgccgtctaaatggctcctcacccatccaagtgtgctggtac
agagacggggtgcttttaagagatgatgaaaatctacagacatcccttgtagataatgtg
gcaactttaaagattttgcaaactgatttgagtcactctggccaatattcctgctcagct
tccaatccacttggaacagcatcttctagtgctagactgacagccagagaaccgaagaaa
tctcccttctttgacatcaagcctgtatctatagatgtgattgctggagaaagtgctgat
tttgagtgtcacgttactggtgctcaaccaatgcgaatcacttggtccaaagataacaaa
gagattcgtcctggaggaaactatacaatcacttgtgtgggcaacactccccacctgaga
attcttaaagtaggcaaaggggacactggtcaatatacttgtcaggcaaccaatgatgtt
ggcaaagacatgtgttcagctcagctcagtgtaaaagaacctccaaagtttgttaagaaa
ttagaagcctccaaagttgccaagcagggagaatccatccacctggaatgcaaaataagt
ggttccccagaaatcaaagtttcatggttccgaaatgacagtgaacttcacgaaagttgg
aaatacaacatgtcatttactgactctgtggcattgcttaccatcaatgaggccagtgct
gaggacagcggggactatatctgtgaagctcataatggtgtcggagacgcgagctgcagc
acagccctgaccgttaaagcgcctcctgttttcactcagaagcctgctccaataggagcc
cttcaaggctctgatgtggttctccagtgtgagatctcgggaactcccccatttgaagtg
gtgtgggttaaagatcgaaagcaagttcgaagcagcaagaaatttaaaatcacttcaaaa
aattttgatacaagtcttcatatccttaatctcgaggcctctgaccttggagaatatcac
tgcaaagctgctaatgaggtgggaagtgatacatgtgtttgcagtgtcaagttcaaagaa
cctccacggttcgtgaaaaagctaagtgacacatcaaccctgactggggacactgttgag
ttaagggctgtcgtggaaggctttcagccaatttctgttgtctggctgaaagacaaaggt
gaagtcatcagagagactgaaaacattcgaatttcattcaccgataatgttgcaaccctc
cagctggtgagcccagaagcatctaattctggaaaatatgtgtgccaaatcaaaaacgat
gctggaaagagagaatgttccgcagtcttgactgtgctagaaccagccaggatcatagag
aagccagaacccatgactgtcaccactggaaatccttttgcactggagtgtgtagtggct
ggaacacgagaactttcagccaagtggtttaaagatggaagagaattatctgcagacagc
aaacatcacattacatttgtcaaaaacgtggcttcccttaagattccatgtgcagaaatg
agtgacaagggcttgtatagctttgaagtgaaaaacagtgttggcaaaagcaactgtact
gtatctgttcatgtttctgatcgcatcgtgcctccttccttcattcgcaagctgaaggac
accagcgcggtcctgggcggctcgactgttttggagtgccgaatcgctggctcggccccg
atttcagtcggctggtttcaggatggaaatgagatccttagtggacccaaatgtcagtcc
agcttttcagaaaacgtctgcactttgaacctaagcttgttggacccctctgacacgggg
acatacacttgtgtggccgccaacgtcgctggttccgacgagtgctctgcggtcctcact
gtccaagagcctccatcttttgaacaaacccctgattctgtggaagttttgcctggaacg
agcctcacgttcaccagtgtcatcagaggcacccctcccttgaagatccagtggtttaaa
ggcagcagagaactggtgtcaggggagtcgtgcaccatctccctggaaggcttcgtcaca
gagctggagctgttggaggtggagccgctgcaaagcggagactattcctgcctggtgact
aatgatgccggcagcgcttcctgcaccacacatctttttgtgaaagaaccagccactttt
gtgaagaggttggcagatttcagtgtggagacaggaagccccatagttctggaggccacg
ttcacgggcacccctcccatctcagtgacctggataaagaatgaatatgctctttcacag
tcccagaactgcagtattaccatgacagaaaaatctaccatactggaaattcttgagagc
acagtagaggattatgcacaatacagttgcctcatagaaaatgaggctgggcaagatatt
tgtgatgctctggtgtctgtcttagaaccaccttattttatcgaacctctggaatatgtg
gaagcagccattggtgaacctataactttgcagtgtaaagtggacggaaccccagaaatt
agaatttcttggtataaagaacacacaaagctgcgatcagctcctgcatataaaatgcaa
ttcaaaaataatgttgcctccttggtcatcaacaaagtggaccacagcgacgtgggagag
tacacatgcaaggcagagaacagtgtaggggcggtcgcttcgtccaatgtgctcattatc
aaagagcgcaagcttccgccttcctttgcaagaaaactaaaagatgtccatgagactctc
ggtttccccatagcatttgaatgtcgcatcaacggttcagaacctcttcaagtgtcttgg
tacaaggacggggtccttttgaaagatgactctaatttgcaaacatcttttgttcataat
gtagcaactcttcagattttgcaaactgaccagagccacgttggtcagtacaattgctca
gcctctaatcctcttgggactgcttcctccagtgccaagctcattctctcagagcacgaa
gtgcctcctttctttgatctaaagcccatatcagtagatcttgctcttggagaaagtggt
tcttttaaatgccatgtcactggaactgcaccaatcaaaatcacctgggccaaggataac
cgagagattcgccctggaggcaactataagatgactctggttgaaaatactgccactctg
actgtgctcaaggtggccaaaggcgatgctgggcaatatacctgctatgctagcaatgtc
gctggaaaagactcttgttctgctcagctgggtgtacaagaaccacccaggttcattaag
aagctagaatcttcacgaattgtgaaacaggatgaatccatgagatatgaatgcaaaata
ggaggatctccagaaatcaaagttttgtggtacaaagacgagactgagatccaggagagc
agtaggttcagaatgtcatttgtggactcggtggcagtgttggaaatgcacaatctcagt
gtggaagacagtggagactatacgtgcgaggcccgcaacgcagcaggcagtgcaagcagc
agcacttccttgaaagttaaagaaccacccattttccgccaaaagccccatcctgttgag
acactgaaaggagctgatgttcaccttgaatgtgagcttcagggcactcccccattccaa
gtttcttggcataaagacaagagagaacttaggagcggcaagaagtacaagataatgtct
gagaactaccttaccagtatccacatcctgaatgtcgatgctgttgacactggagaatat
cagtgtaaagccacaaacgatgttggaagtgacacttgtattggttctatcactctgaaa
gcaccaccgagatttgtgaaaaagctcagtgacatttctaccatcattggtgaagaagtg
cagctgaaaaccactgttgaaggccctgaaccaatctcagtggtgtggttcaaagacaaa
ggagaaattgtacgtgaaagtgacaacatatggatttcttactcagacaacattgcgacc
ctacagttttcaagagcagaaccagccaatgctgggaaatacacctgtcagataaaaaat
gacgctggaatgcaggaatgcttcgccacactgtccgttcttgagcctgcagcaattgtg
gaaaagccaggatccgtaaaagttaccacaggagacacctgcaccttggagtgtacggta
gctggcacacctgagctcactactaagtggtttaaagatggaaaagagctgacaagtgac
agcaaatacaaaataagcttcttcaacaaagtctctggccttaagatcatcaatgtggta
cccagtgacagtggggtctatagttttgaggtccaaaaccccgttggcaaagacagctgc
acagcttcggttcaggtttcagaccgaattattcctccttcattcacaagaaaattgaaa
gagacgaacggtctatcaggatcctctattgtaatggagtgcaaagtctatgggtcaccc
ccaatctctgtctcctggttccacgaaggaaatgaggtcagcagtggcaggaaataccag
accaccctgacagataacacttgtgctttaactgtgaacatgctagaagaatctgatgct
ggtgactacacatgtatagctaccaatgtggctggttctgatgaatgcagtgctcctttg
actgtgagagagccaccatcttttgttcagaaacctgatcccatggatgtcttaactggg
accgatgttacttttacaagcatcgtaaaaggaacaccgccattcagtgttagctggttc
aagggtagcagcgaactggtacctggagccaggtgcaacgtgtctttggaggatacagtg
gctgaactggagctgtttgatgtggatacatcccaaagtggagaatacacttgcatagtt
agtaatgaagctggcagggcttcttgtacaactcatctcttcgtaaaagcaccagccaaa
tttgtgaagaggctcaatgattatagcatagagaaaggaaaacctcttatcctagagggg
acattcactggaactcctcccatttcggtcacatggaagaaaaatggcatcaatgtaact
ccttctcagaggtgtaacataaccaccactgaaaagtcagcaatcctggaaatcccaagt
agcatggtagaggatgccggccaatacaactgctatattgaaaatgcttctgggaaggat
tcctgttcagcacaaattttgatactagaaccaccatatttcatcaagcagttggagcct
attaaggtgaccgttggagattctgcctctttacaatgccaacttgctggaacccctgag
attggggtatcatggtataaaggagatacaaaattgagacccaccactacctgcaaaatg
cattttaggaacaatgttgccaccctggttttcactcaggttgacactaatgacagtgga
gaatatatctgcagagcagaaaacagtgtgggagaagtttcttcatcaactttccttact
gttcaagagcaaaagcttccaccatcattttctcgacaactgagagatgtgcaagaaaca
gttgggttgccagttgtttttgaatgtgccataaatggatcggaacctatctcggtgtct
tggtataaagatggcaaaccactgaaagacagctccaatgtgcaaacatcgtttttagat
aaagtagccactctcaatatttttaagacagacaggagcctctcaggccagtattcatgc
acggctacaaatcctataggctcatcctcttctagtgccagactcatcctcacagaggga
aagaacccacccttctttgatattcccctgggcccaatggatgctgtggtgggagaaagc
gctgacttcgaatgccacatcactggaacacaacccataaaggttagctgggccaaagac
agccgagagatccgaagtggcgggaactaccagatcagttacctggaaaacagtgctcac
ctgacaatcctcaaagtggacaaaggcgactctggacaatatacctgctatgctgtgaat
gaagtgggcaaagactcctgtacagctcagcttaatataaaagaacggctaatcccacca
agtttcactaaaaaactctctgagacggttgaggaaacagaaggaaattcattcaaactt
gagggccgggtggctggttcccagcctataggtgttgcttggtacaaaaataatgtagag
ctacatccaacttctaactgtgaaatcactttcaagaacaacacactactgctgcaagtc
aagaaagcaggcatggccgatgctggcttatacacgtgcaaggtgtcaaacgacgcaggc
tcagctctgtgcaccacgtccattgtcatcaaagaacctaagcagcctcctgtatttgat
cagcatctcactcctataacagcaagtgaaggagaattcgtgcagctcagctgccatgtg
cggggatccgagcccatccgggtccagtggttgaaggctggcagggaaataaagcctgcg
gacaggtgcagcttcagctttgctagtggaacagctgtgctggaactcaaggatgtggtg
aaagaggattcaggagattatgtgtgtaaagcttcaaatgtggctggaagtgacacttcc
aaatcaaaagtgaccataaaagaaaagcctgctgcagctccagcagctaagaaggcagca
gtagatggaaatctcttttttgtatcagaacctcagagtatcagagttgtagaaaaaacc
actgcaacattcattgcaaaagttggaggtgatccgatcccaaatgttaaatggacaaaa
gggaaatggagacaactgaaccaaggaggtagaattcttatccaccaaaaaggcgatgaa
gcaaaactggaaattagagatacctcaaaaacagattctgggttgtaccgatgtgttgcc
tttaacaaacatggtgaaattgaaagcaatgttaacctacaggtggatgaaaggaagaaa
caggagaaaattgagggtgaccttagagcaatgctgaaaaagactccagtcttaaagaaa
ggaactggggaagaagaagaaattgatatcatggaacttctcaaaaatattgatcctaaa
gaatatgaaaaatatgcccgcatgtatggaatcactgacttccggggtctgcttcaagca
tttgagctactaaagcaaagtcagacagaagagacacatagattggaaattgaggagcta
gagaagtcagagaaagatgaaaaggaatttgaggaacttgtgtcatttatccagcaaagg
ctgacacagacagagcctgtcactctgatcaaggatattgaaaaccagacagttttgaaa
gataatgatgctgtctttgaaattgacattaagattaattatccagaaatcaagctctca
tggtacaaagggactgaaaaactggaacccagtgataaatttgaaataagcattcatggt
gatcgacatacattaagagtcaaaaactgtcaacttaaagaccagggcaattacagactg
gtctgtggtccccatattgcgagtgccaagctaactgtcattgagcctgcctgggaacgg
caccttcaggatgttactttgaaagaaggccagacttgcaccatgacgtgccaattttct
gtgccaaatgtaaaatctgaatggttcagaaatggcagaatccttaaaccccaaggaaga
tttaaaacagaggtggagcacaaagcccataaactgaccattgccgatgttcgggcagaa
gaccagggtcagtacacctgcaaacatgaagacctggagacctccgcagagctcagaatc
gaagcggaaccaattcagtttacaaagcgcatacagaacattgtggtgagtgaacaccaa
tctgctacctttgagtgtgaagtgtcctttgatgacgccattgtaacctggtacaaaggg
cccatggaactcaccgagagccagaaatacaacttcaggaatgatggtcgctgccattac
atgaccatccacaatgtgaccccagatgacgaaggtgtctattcagtaattgcccgtctg
gaaccaagaggtgaagccagaagcacagcagagctgtacttaacaacaaaagaaatcaaa
cttgagctgaagcctcctgatatccccgactccagagttccaatccccaccatgcctatc
agagcagtaccaccagaagaagtccctcctgcggttgctccttctatccctcttttgctg
ccattacctgaagaaaagaaaccaccagcaaaacgtgttgaagtgaccaaaaaggctgta
aagaaagataccaaaaaagttattccaaagcccaaagaagaggcaccaccacctaaagag
gttgccaagaagcccccacctccaactgccttaattccagcaaaagctcctgagatcatt
gatgtatcctctaaggctgaagaagtaaaaataacaaccattactagaaagaaagaggtt
cagaaagaaagagaggctgtgtacgagaaaaagcaagcagtctatgaggagaagaaagtt
tacatagaatctatggtggaagaaccctatgatgaactagaagtggaaccatacacggag
ccatatgaagaaccctattatgaagaaccggacgaagactatgaagagatcaaggtcgaa
gctaaacgggaagtccatgaggaatgggaagatgactttgaagaagagcaagaatactat
gaaaggaaagagggttatgatgaaggggaggaagagtgggaagagtcttaccaagaaaga
gaagtaattaaagttcaaaaggaggttcgtgaagaattagcagagagaaaaattccagca
aaagtacctgaaaagaaagtaccacctcctaaagttttaaagaagccagtagttgaaaaa
gttgaaaagactactcgaagaatggaagaagaaaaagttcaagtcaccaaagtacccgaa
gtttcaaagaagattgtcccacaaaaaccttcccggactccagtacaggaagaaattatt
gaagtgaaagtaccagctgtgcatacaaagaagatggttatttcagaagaaaagatgttc
tttgcttctcatacagaggaggaagtgtcagtcacagtccctgaggtacaaaagaaaact
gttactgaagagaaaattcatgttgctgtttccaaaaagattgagccaccacctaaagtc
cctgagccacctaagaaaccagttccagaagaagaggtccctgttcccattcctaaaaag
gtggagcccccaccagccaaagttcctgaggttcccaagaaacctgtaccagaggagaaa
aagccagttcctgtaccaaagaaggaacctgctgctcccccaaaagttccagaggtgcca
aagaaaactgtccctgaagcaaaggttcctgttcctttggcggagaaaaaggaagtgccc
ccagctaaagttcctgaagtacagaagagagtgatcacagaagaaaaagtaaccatcatt
actcaaagagaggaatctccaccaccagcagagccagaaataccaaaaaagaaagttcct
gaagaaaaacggcctgttcctccaaaagaggaagaaactcctccaagaaaagtgccagct
gtacctaagaaacctgtcccagaggagaaagttccagtgccagttcctgtagctaagaaa
gctcctcctccccgagctgaagtttctaagaaaactgttgtggaagaaaaaagatttgtt
ggtgaagaaaaactgtcctttgcagttcctcagagagtggaagtcatgcggcatgaaggt
atatcacctgaagaggaatggagttattcagaagaagaagaaagagtgtctgtttcagtt
tatagagaagaagagagagaggaggaggaggaggaagtggagattacagaatatgaagtg
atggaagagccagaggaatatgttgtagaagaaaagctgcacattatttctaaaagagtg
gaagctgaaccagccaaagtgcccgagaagaaaattatatcaaaaccagaagttcctgcc
aaagttgaggagcgtccaccactgaaagttcctgaaccacctaagaaaatcataccagaa
aagaaagttcctgctccaattcctaagaaggaaaaagtaccaccaccagcagtgccagaa
gagccaaagaaaccagttccagaaaaaagggttcctccaaaagaggttaaaatagaagaa
cctcccccggctaaagtgactgagaggcacatgcaaattactcaggaagaaaaagttctt
gttgctgtaactaaaaaagaggagcctccaagagcaagagtgcctgaggaacctaagaga
gctgttccagaagaaaaacttccaaaactcaaacctagaagagaaccagagccaccagct
aaagtgactgaactgcgaaaaagagtcattgcagaagaaaaagtatccattgaagttcca
gagagagaacctcgtcctacaaaagaagtaagtgtaacagaagagaaaaaatggtcttac
acacgagaagaagaaatagtttcagaacaacgggaagaggaatatgaggcatatgaagaa
tatgaggattataaagaatttgaagaatatgaaccaacagaagaatatgaccaatatgaa
gattatgaagagcgtgagtttgaacactatgaagagtataaagaacatgaagaatatatc
acagaacctgagaagcccattccagtaaaacctgtccaagaagaaccagttcccacaaaa
ccaaagcctccaccagctaaagtgccgaagaaagctgtccctgaagaaaaagtgcctgtg
cccgttcctaagaaactcagacctccaccgcccaaagtgcctgaagaaccaaagaaagtt
gttgaagaaaaaatacatatttcgattaccaaacgtgaaaaacagcaggtgactgaacca
gctgctagagtgcccatgaaacccaagagggttatcccagaagcaaaagtacctgtccct
aaaaaggaagtggcagctcctgttagagtgccagaagtgcctaaaaaacgagaacctgaa
gaagttgcctttgaagaggaagctgaaacctacgaagaagaatatttttatgttcatgaa
gaagaagagtaccttcatgaagaagaagagcacataactgaggaagaagtggtgccggtg
ataccaatcaaagtgcctgaggtgcctaagaagcctgttccagaagagaagaaacctgtt
cctgtccccaaaaagaaggaagtcccaccagcaaaagtgcctgaggttcctaagaagcca
gaggagaaagctcctgtaccaattcctaaaaaagagaaggctccaccagctaaagttcct
gaagtgcccaagaaacctgtaccagaagagaaagtaccagtgccagttcctaaaaaggtg
gaagctccaccagccaaagtgccagaagttcccaagaaacctgtgcctgagaagaaggtg
ccagttcctgctcctaagaaagtggaggccccacctgcaaaagtgcctgaggtgccaaag
aagctcatcccggaagaaaagaaaccaacacctgttctgaaaaaaatggaagctccagca
cccaaagtgccaaagaaacgtgaagtagtcccagttcctgtagctctacctcaggaagag
gaagaggaagaggaagttccatttgaggaagaaattgctcctgaagaggaaattctacct
gaggaagaggaagttcttcctgaagaagaggaagaggtcattcctcctgaggaagaagaa
gttcctcctgaggaagaggaacttgtacatgaggaagaagaagtacctgaagaagaggaa
gttcttccagaaattaaacctaaggtgccagtacctgcaccagtgcctgaggtcaagaag
aaagtgacagagaagaaagtagttgtgaccaagaaagaggaagctcctcctgccgcagtt
cctgaggtacctgagaaggtggaagaaagacaaatcattcctcctaaagaagaagaagtt
ccaccagtagaagtgtttgaggagcctgaagaacctattcctgaagagatcccagaagag
ccacctagcatagaggaggttgaggaggtggaaccacctagagtgcctgaagtggttaag
aaaataatacctgaagcacctactcctgttcctaagaaagtggaggcaccaccagctaaa
gtgccagagaaaatttctgaggaaaaggtacctgttcctgtccagaaaaaagaggcaccc
ccagctaaagttccagaaaagaaagtcccagaaaagaaagttccagaaaagaaagtcctt
attcctaaaaaggaagctgttacccccgctaaagggagaactgttcttgaagaaaaagta
tcatttgcttatgaacaagaggaagtagttaaacaaagaatagaatttgaagtagcagaa
gcagaagtagaagaagttcttgaagatcagttccatgaagttcaagaatattttgaagaa
gaagaatttcatgaggtagaggaattcatcaaagtagaagaacgcagatttgaagaacac
aaagttgacaaagttcatagagttatagaattcttagaggccgaagaagtggaagtatat
gaaaaacccaaagctccacctaaagggcctgagatagctgagaaaatcatccctccaaaa
aaaccacccactaaagttgttcctcgagaagagccacctactaaagtacctgaagtcacc
aagaaaattgtggtagaagaaaaagtacttgttcctgaaagtccagaatatcccccaact
gaagtacctgaggctcccaaagaaagtgtccctgaaaagaaagtgcccaagataccacct
aaaaagccagaagccccacccgttacagtgcctgaggctcccaaagaagttgtccctgaa
aagaaagtgcctgtggctcctcctaaaaagccagaaatcccacctgccaaagtgcctgag
gtgccaaaggcagctgtcccagtaaagaaggtgcctgaagctgttccccccaaaccggaa
agtcctcccccagaagtgcctgaagtgccaccaaaggaagccatcccagaaaagaaagtg
cccgtggctcctcccaaaaagccagaagctccgcctcccaaagtgcctgaggtgcctgaa
gaaattgtccatgaaaagaaagtacccatggtgcctcctaaaaagccagaagccccacct
gttacagtgcctgaggtgccaaaggcagctgtcccagtaaagaaggtgcctgaagctgtt
ccccccaaaccggaaagtcctcccccagaagtgtatgaggaggaggctgaggaaattgct
ccggaagagcctccaattgaagtcctggaagagcctgagccagttgaagtcccagaagag
cctgagcctgcagcacctccaaaagtgatggtgcctcctaagaagccagttcctgaaaag
aaagctgtcgttgccaagaaaccagaaccaccaccagtgaaagtgcccgaagtacccaag
gaggttgttcctgaaaagaaaatgcctcgagtggttcccaaaaaaccagaagttccacca
gctaaagtgcctgaagttgcaaaagaagttgttccagaaaagaaagtaactgttcctcaa
aagccagaagtccctccacctaaagtgccagaggtgccaaagaaacctgtcatagaagag
aaaccagctgtccctgttcctgagaaagtggagtctcctcccccagaagtatatgaagag
cctgaggaaattgctcctgaggaggaagagccagtcccggttgtggaagaggaggaacct
gaagccccacctccaccagaacctgaggagcccaagaagaccgtcccagagaagaaattt
cctgtcatcaaaaagccagaacctccacctcctaaagaacctgaacctgaaaagaaggtt
attgagaaaccaaaactcaaaccaagacccccggctcctgctcctcctccaccaaaggaa
gatgtaaaggagaaaatgttccaacttaaagctgttacaaagaagaaagttccggaaaag
cctgaagttccagaaaaagtggagcttacaccagtgaaagtgcctggagctgaaaagaaa
gttcgcaaattacttcctgaacctaaacctcagccaaaggaagaagttgttctgaaaagc
gttctaagaaagaaacctgaagaagaagaacctaaagtagaacctaaaaaagtagaaaaa
attaaaaaaccagaagtaccggcaccacctccaaaagaggttgaagcacctccagctgtt
actacaagggaaaggaagattcctgaaccaacaaaagtgcctgaaattaagccagcgata
cctctccctggacctgaaccaaaaccaaaacctgaaccggaagtgaaaacaataaagcca
cctcctgtggagccagcaccaacccccatcgctgccccagtgactgtgccagtggtcgga
aagaaagcagaagccaaagcacccaaggaggaagctgccaagccaaaaggtcccatcaaa
ggtgtagccaaaaagactccttcaccaatagaagctgaaaggaaaaagttaagaccagga
agtggtggggagaaacctcctgatgaagccccgttcacctatcagctaaaggctgtgcca
ctaaagttcgtaaaagaaatgaaagacattgtcttgacagaagcagagtctgttggctct
tctgcaatctttgaatgcttagtctccccctccactgccattacaacctggatgaaagat
ggtagcaatatccgtgagagtccaaagcacaggttcatcgcagatggtaaagacagaaag
ctgcatatcattgatgttcaactctctgatgctggtgaatacacctgtgttttacgtttg
ggaaataaagaaaagacctccacagctaagcttatcgtagaagaacttcctgtgcgtttt
gtgaaaacactggaggaggaagtgacagtggtcaaaggacagccattgtacttgagctgc
gagttaaacaaagagcgtgatgtagtctggaggaaggatgggaagattttggtggagaaa
cctggccacattgtgccagggatcattggcttgatgcgggctctgaccatcaacgatgca
gatgacaccgatgctggaacatacacagttactgtggaaaatgccaacaacctggagtgt
tcatcttgtgtaaaagtagtagaaatcattagagattggctggtgaaacctatacgagat
cagcacgtgaaacccaaggggacggctgttttcagctgtgacatagcaaaagatactcca
aatattaagtggttcaaaggatatgatgaaatccccatggaaccaaccgataagactgag
attctgaaagagggaaatcatctatacctcaaaattaagaatgctatgccagaagacatt
gatgaatatgcagtggaaattgaagggaaaagataccccgcaaagctgacacttggagac
cgtgaagttgagctacttaaaccaatagaggatgtcaccatttatgagaaagaaagtgca
agctttgatgcagaaatctcagagacagatattcctggacaatggaagctgaagggagaa
cttctgaggccctcacctacttgtgagatcaaacaagaaggaggaaaacgcttcttaact
ttacacaaagtcaaattagaccaagctggtgaagttctctaccaggcacttaatgcaatt
accactgccattctgacagtcaaagaaatcgaacttgactttgctgtgcccttgaaggat
gtcactgttccagaaagacgacaggctcgatttgaatgcgtcctcacccgagaggcaaac
gttatatggtctaaaggacctgatataatcaaggcgtctgacaaatttgatatcattgcc
gatggaaagaaacatattcttgttatcaatgattctcaatttgatgatgaaggcgtctat
actgcagaggtggagggcaagaagacctcagcacaattatttgtgacaggtataagattg
aaattcatatcacctcttgaagatcaaacagtgaaagaaggcgaaacggcaacttttgtt
tgtgaactttctcatgaaaagatgcatgtggtctggttcaaaaatgataacaaactgcac
acaaccagaacagtcctcatgtcttccgaaggcaagactcataaactggaaatgagagag
gtgaccttggatgatatatctcagataagagcgcaagtcaagaacctgagctccacggca
catctaaaggtcttagaggccgatccttacttcactgtgaaactacatgacaagactgga
gttgagaaggatgacatcatcctgaagtgtgaagtaagcaaagatgtgccagtgaaatgg
ttcaaagatggcgaagagcttgtcccttcacccaaacactccatcaagacagatggcctg
cgccgcatcttaaagatcaagaaggcagagcttaaagataaaggcgaatatgtgtgtgac
tgtggcacagacacaaccaaagctaacgttactgtggaggctcgcctaatcaaagtggaa
aagcctctctatggagtggaagtgtttgttggtgaaacagcccgctttgaaattgaactt
tcggagccagatgttcacggccagtggaagttaaaaggagagcctttgactgcttcccct
gactgtgaaatcattgaagatgggaagaagcatgttctggtcctttataactgtcagcta
gatatgactggagaggtttccttccaggcagccaatgctaaatccgcagccaatctcaaa
gtgaaagaactgcctctcattttcatcacacctctcagtgatgtcaaagtctttgagaag
gatgaggctaaatttgagtgtgaagtatccagagagcccaaaacattccgctggctgaaa
ggaactcaggaaatcacaagtgatgacaaattcgagcttataaaggatggcactaggcat
tcaatggtgatcaagtcagctgcttttgaagatgaagcaaaatacatgtttgaagctgaa
gataaacgcacaagtggcaaactgatcattgaaggaatccggctcaaattcctcacacct
ctcaaagatgtgacagccaaagagagggaaaatgctgtgtttactgtggagctctcccat
gacaacatcccagtgagctggttcaagaatgaccagcgcctccataccagcaagcgagtc
tccatggatgatgctgggaaaatgcactcaatcacattcaaagatctgtctattgatgac
acctcccagattagagtagaagccatgggaataagttcagaagctaaactcactgtgctt
gagggagatccatactttactggaaagcttcaagattacacaggtgtcgagaaggatgaa
gtggttcttcagtgtgaaattagcaaagcagatgcaccagtgaaatggtttaaggatggg
aaggaaataaagccatctaaaaatgctgttattaaagcagatggcaagaagcgcatgcta
atcctaaagaaggccctgaaatcagatattgggcagtatacctgtgactgtgggacagat
cagacgtccggaaagcttgatattgaagatcgggaaattaaactggtgcgacccctgcac
agcgtggaggtgatggagactgagactgctcgctttgaaaccgaaatctctgaagatgat
atccatgccaactggaaactcaagggagaggcactactccagacacctgactgtgaaatt
aaggaagaaggcaagatacacttccttattttgcacaactgccgcctggatcagactggt
ggggtggatttccaagctgccaacgttaaatctagtgcccacctcagagttaaaccacga
gtaattggtcttctgagacctctgaaggatgtcacagtgactgcgggggaaacagccacc
tttgactgtgagctctcttatgaggatatcccggtggaatggtatctcaagggcaagaag
ctggagcccagcgacacggtggtcacacgttcagaaggaagagtccatacacttactttg
agggatgtaaagttagaagatgctggggaagtccaactaacagcaaaggatttcaaaact
caagccaatctctttgtgaaagaacccccagttgaattcactaagccccttgaggaccag
acggtcgaagaggaagccactgcagtactggagtgtgaagtatccagagaaaatgctaag
gtgaaatggttcaaaaatgggacagaaatcctcaaaaacaagaaatacgaaattgtcgct
gatggcagggtcagaaaacttattatacacaactgtaccccagaggatatcaaaacatat
acttgtgatgctaaggattttaagacttcctgtaacctgaatgtcgtgcctcctcatgtg
gaattcctaagaccactcactgatcttcaagttaaagaaaaagaaatggctcgctttgag
tgtgaaatttctcgagaaaatgctaaggttcagtggttcaaagatggtgctgaaattaaa
aagggcaaaaagtatgacatcatatcaaagggagcagtacgcattcttgtcatcaacaaa
tgtctactgaatgatgaagcagaatattcctgtgaagtaaggacagcaagaacttctggc
atgttgacagtcctagaagaagaagctgtctttacaaaaaatcttgccaatgttgaagtt
agtgaaacagacactatcaaactggtttgtgaagtgtctaaacctggagcagaagtgatt
tggtacaaaggtgatgaagaaatcatcgaaacaggaagatttgaaatacttgccgatggg
aggaagagaatcctgaccattcaaaatgctcaccttgaggatgctggcaactacaactgc
cgactcccaagttcccaaactgatggcaaagttaaagtgcatgaacttgctgctgaattt
atctcaaaacctcaaaacctggaaatcctggaaggagaaaaggctgaatttgtctgcact
atatcaaaggaaagcttcgaagttcaatggaagagagatgataagacacttgaagctgga
gataaatatgatgtgattgctgatggcaaaaagagggtcctcgttgtgaaagatgccaca
ttgcaagacatggggacttatgtggtcatggtgggagccgccagagcagcagctcacttg
acagtaattgaaaaactcaggatcatagttcctcttaaagacacccgtgtgaaggaacaa
caagaagttgtcttcaactgtgaagtcaatactgaaggtgccaaagccaaatggttcaga
aatgaagaagccatatttgatagtgcaaagtacattattctccaaaaagacctggtctac
accctcagaattagagatacacgattagatgaccaagccaaatataatgtgtctctgacc
aatcatagaggtgaaaatgttaaaagtgcagccgacctaattgtagaagaggaagatctt
aggattatcgagcctcttaaagatgttgaaacaatggagaagaaatctgtcacattctgg
tgcaaggtgaatcgtctcaacgtcacactgaaatggaccaaaaatggggaagaagtacct
tttgacaaccgtatatcataccgaattgataagtataagcactctctaatcattaaagat
tgtggcttcccagatgaaggtgaatatgtggtcactgctggacaagataaatctgtggct
gaacttcttataatagaagccccaacagaatttgtggaacacttggaagaccagacagtc
accgagtttgatgatgctgtcttctcctgccagctctccagagaaaaagcaaatgtaaaa
tggtacagaaatgggagagaaatcaaagaaggcaaaaaatacaaatttgaaaaagatgga
agtatacatagactcattataaaagattgcaggctggatgacgagtgtgaatatgcttgt
ggagtagaagacaggaagtcacgagctagactttttgtggaagaaatccctgttgagatc
atcagacctcctcaagacattcttgaagctcctggtgctgatgttgtctttttagctgag
ctcaacaaagacaaggtggaagtccagtggctaaaaaataacatggtcattgtccaaggt
gacaaacatcagatgatgagtgaaggaaagatacacaggctacagatttgtgatattaag
ccccgtgaccagggtgaatatagatttgttgccaaagacaaagaagccagagctaagctt
gaactggcctctgcacctaaaatcaagacagctgatcaagaccttgtggttgacgttggc
cagcctctcacaatggtagtcccatatgatgcctaccccaaagcagaagctgagtggttt
aaagaaaatgaagccttatcttcaaaaactgttgacactacagctgaacaaacttctttc
agaattttagaagccaagaaaggagacaggggaaggtataaaatcgtgcttcagaataaa
catggaaaagcagaagcatttatcaatttacaggttattgatgttcctggaccggtacgt
aacttagaagtgacagaaacatttgatggtgaagtaggccttgcctgggaagaaccatta
actgatggtggaagcaaaatcataggttacgttgttgaaagacgtgacatcaagagaaag
acgtgggttctagccactgaccgtgcagatagttgtgaatttactgtcactggactacaa
aaaggaggagttgagtacctattcagagtgagtgcaagaaacagagttggcactggtgaa
ccagtagaaactgacaatcctgtagaggcaaggggtaaatatgatgttccaggccctcct
ttgaatgtaaccatcactgatgtgaataaatttggtgtctcactgacatgggaaccacca
gaatatgatggtggtgcagagatcacaaactatgtcattgaattaagggacaagacttct
atcaggtgggacactgccatgactgtaagagctgaagacctgtctgccactgtcactgat
gtggtggaaggacaggagtacagcttccgtgtcagagcccaaaaccgaattggagttgga
aaaccaagtgcagctacaccctttgtcaaagttgctgatccaattgagagaccaagtcct
cctgtgaacctgaattcctcagatcagactcagtcatcagttcagctcacatgggaacct
cctctgaaagatggaggaagcccaatattgggctatataattgagcggtgtgaagaagga
aaagataattggatccgttgcaatatgaaacctgtccctaaactgacttacaaggtcact
ggattgcaaaaaggaaataactatttgtatagagtatctgcagaaaatgctgctggtgtc
tcagatccatctgaaattcttggtcctctaactgctgatgatgcatctgttgaaccaaca
atggatttaagtgcttttaaagatggtctggaagttatcgttccaaatcctgtcaagatc
ctggttccaagtacaggctatccaaggccaactgcaacctggtcttttggagagaaggtt
ctagaagcaggagaccgtgtgactatgaagaccatatctgcctttgctgaacttgtcatt
tctccaagtgaacgtccagacaagggcatttatacactgacattaaaaaatcgtgtgaaa
tcaatttctggggaaattaacgtcaatgtaattgctcgcccaagtgcacccaaagaactg
aaatttactgacataaccaaggattcagtacatctgacttgggaaccaccagatgatgat
ggaggaagtccgttgaccggatatgtcattgaaaagcgagaagtcagccggaaaacatgg
actaaagttatggactttgtgactgatctagaattcacagttcctgatcttgttcaagga
aaagaatatttattcaaagtctgtgctcgtaacaagtgtggccctggagaacctgcatat
attgatgaacctgtaaatatgtcagctcctgcaacggtacctgacccaccagagaatctt
aaatggagagatcggacagccaaaagcatcttcctaacatgggaaccacctaaaaatgat
ggtggttcacgcatcaaaggatatttagttgaaaaatgtccacgtggttcagacagatgg
gttgcctgtggagaacctgttgcagaaacaaaaatggaagtgacaggtcttgaggagggc
cagtggtatgcctaccgtgtgaaggccttgaatagggtgggcgctagcaagccgtgcaga
cccacagaagaaatccaggctgtggacacacaggaggccccagaaattttccttgatgta
aagctccttgctggtcttactgtaaaagctggaacaaagattgaacttcctgctactgta
actggaaaacctgatcctaaaataacttggacgaaggctgatctggtcttgaagcaagat
aatagaatcactattgaaaatgttcctaaaaaatccacagtgactatcatggatagtaag
agaagtgacaccggaacctacatcatcgaggctgtgaatgtctgtggccgggccactgct
gtggtggaagtgaatgtcttagataaacctggaccaccagctgcttttgacatcacagac
ataaccagcgagtcatgtcttctaacatggaacccaccgcgagatgatggtggatccaag
gtcacaaactacgttgtggagaggaaagcgactgacagtgaagtgtggcataaactctca
tcaacagtcaaggacacaaacttcaaggcaaccaaattaacacccaataaagagtacatc
ttccgagttgctgcagaaaacatgtatggtgttggtgagccagtccaggctactccgata
atagccaaatatccatttgatccacctggacctccaactcgcctagagccttcagacatc
actaaagatgcagtgactctcacatggtgtgagccagatgatgatggaggcagccccatc
actggatactgggttgaaagattagatccggatactgataaatgggttagatgcaataag
atgccagtaaaggacacaacatatagagtgaaaggtctcaccaataagaaaaaatacaga
ttccgtgtgttggctgaaaatctggctggacctggaaagccaagtagatcaacagaacca
atcctaataaaggatcccatagatcctccttggcctcctggaaaaccaactgtaaaagat
ataggcaaaacatcattaacattgacttggacaaagccagaacatgacggtggggcaaag
attgaatcttatgtcattgaaatgctaaagactggaacagaagactgggtcagagtagcg
gaaggggttccaaccactcagcatttacttccggggctcatggaagggcaggagtactca
ttccgggtgagagccgtgaacaaggctggagaaagtgagcccagcgaacccagcgaccct
gtgctttgccgggagaaactatatcctccatcaccacctcgttggcttgaagttattaat
atcacaaaaaatacagcagacctaaaatggacagttcctgagaaagatggagggtcccct
atcaccaactacattgtggaaaagagagatgtgaggcgaaaaggctggcaaacagtggac
accaccgtcaaggacaccaaatgcacagtcaccccactgactgagggctctttgtatgtg
ttccgagttgctgcagagaatgcaataggacaaagtgactacactgaaattgaggattct
gtcctggccaaggacacctttaccactcctggaccaccctatgccctaacagtggttgat
gtgacaaaacgacatgttgacctaaagtgggagccacctaaaaatgatggtgggagacca
atacagagatatatcattgagaagaaagaaaagttaggcactcgttgggtgaaagctgga
aagacctcaggacctgactgtaactttagagtaactgatgtcattgaaggaacagaggtc
cagtttcaggttcgggcagaaaatgaagctggagttggtcacccaagtgaacccacagaa
atcctaacaattgaagatccaacaagtcctccctcacctccccttgacctacatgtgact
gatgctgggaggaagcacattgccattgcttggaagcctccagagaaaaatggtggaagt
ccaatcataggataccatgttgaaatgtgtccagtaggcactgagaaatggatgcgagtt
aattctcgcccaataaaagatttgaaattcaaagttgaggaggggattattcctgacaaa
gagtacgttctaagagtgagagctgtcaatgctgttggtgtcagcgagccatctgaaatc
tctgaaaatgtggttgccaaagacccagactgcaagccaacaattgagatggagactcat
gacattgtcgttattgaaggagaaaaattaagcattcctgttccctttagagctgtccca
gttccaactgtcagctggcataaagatggcaaagaaataaaagcaagtgacaggttgaca
atgaagaatgatcacatttctgcacaccttgaagttcccaagagtgtccatgcagatgct
ggcatttacaccattacactggaaaataaactcggctcagcaactgcctcaatcaatgtc
aaagtcataggcctacctggtccatgcaaagatattaaagcaagtgacgtgaccaagagt
tcttgtaagttaacctgggagcctccagaatatgatggtgggagcccaattctccattac
atcctggaacgcagagaagctggaagaaggacgtatattccagtcatgtctggtgagaac
aagctgtcttggactgtgaaggatctcataccaaatggcgaatacttcttccgtgtcaaa
gctgttaacaagattggtggaggagaatatattgaactgaaaaatccagtcattgctcaa
gatccaaagcagccccctgatccacctgtagatgttgaggtccataatcctacagctaag
gccatgactattacatggaagccacctctgtatgatggagggagcaagataatgggttac
atcatcgagaagattgcaaagggtgaagaaagatggaaaagatgcaatgaacacctggta
ccagtgctgacctatacagcaaaaggacttgaagaggggaaggagtaccaattccgtgtg
cgagcagagaatgctgccggtattggtgaaccttctcgggctactcctccaaccaaagct
gtagatcctattgatgctccaaaagtcattctgagaacaatcttagaagtaaaacgaggc
gatgaaattgcacttgatgcaaccatttctggatcaccttatccaactattacatggata
aaagacgaaaacgtcattgtaccagaggaaattaagaagcgaccagcagccccggttagg
aggaagaggggtgaagttcaagaagaagaaccatttttcctgactctgacagagcgtttg
agtatcaataatagcaaacaaggagaatctcagcttcgtgtccgagattctctccgacct
gaccacggcctgtatatgatcaaagctgaaaatgaccatggtgttgcaaaagctccttgt
actgtctgtgtgttagatacaccaggaccaccaatcaacttcgtatttgaagatattaga
aagacctcagtcctctgtaagtgggaaccacccctcgatgatggtggcagtgaaatcata
aactacaccctggaaaagaaagacaagacaaaacctgactcagaatggattgttgtcact
tcaacacttagacattgcaaatattcagtaacaaaattaattgaaggaaaagagtacctc
ttccgtgtaagagctgaaaataggcttgggcctggaccaccatgtgtttcaaagccactt
acagctaaagatccatttgaaccacctgatgcacctgataagcccattgtggaagaggtt
accagcaacagtatgctagtgaaatggaatgaacctaaagataatggaagccccatcttg
ggttactggcttgaaaaacgtgaggttaatagtacacattggtctcgtgtcaacaaaagc
cttctgaattctttgaaagccaaggtagatggcttattagaaggactcacctatgtcttc
agagtatgtgctgaaaatgcagctggacctggaaagttcagtccaccttcagatccccaa
acagcacgtgatccaatctctccacctgggccacctatcccaagagttgctgacacaagc
tctacaactattgaactggaatgggaacctccagctttcaatggtggtggggaaattatt
ggctacttcgttgataagcagttggttggcaccaatgagtggtcacgctgcactgagaag
atgatcaaggaccgtcagtacactgtcagagaaatccgagagggtgcagattacaaactt
agagtgagtgccgtcaacctggcaggtgaaggaccacctggagaaacagaacctgttacc
gtggctgaaccactagagcctccagctgtggaactcgatgtttctgtcaaggctggaata
caaataatggctgggaagactcttagaattccagcagtggttactggccgccctgtgccc
acaaaagtatggaccatagaagaaggggagctggataaagatcgtgttgtcatagagaat
gtcggaaccaaatctgaactaattatcaaaaacgcattgagaaaagatcatggcagatat
gtgattacagccactaatagctgtggttccaaatttgcagcagcccgggtagaggttttt
gatgtccctgggccagttcttgacttaaaacctgttgtaacaaacagaaagatgtgtctg
cttaactggtctgatccagcagatgatggaggaagtgaactcacaggcttcattattgaa
agaaaagatgccaagatgcatacttggagacaaccaatagagactgagagatctaaatgt
gacatcacaggtcttcttgagggacaagaatatatgttccgtgttattgccaagaacaag
tttggttgtggccctcctgttgtaataggaccaattcttgcagttgatccactaggtcct
ccaacatctcctgaaaggctcacatatacagaaaggaccaagtccaccatcacccttgac
tggaaagaaccccgcagtgatggcggctctcccatccaaggatatatcattgaaaagcgg
cgtcatgacaaacctgactttgaaagagttaacaagcgactctgcccaaccacatctttt
ctggttgaaaatcttgatgaacaccaaatgtatgagttccgggtcaaagccgtcaatgag
attggtgaaagtgaaccatccctgcctcttaacgtagtcatacaagatgatgaagtgcct
ccaactattaagttgcgtctggctgttcgaggagacaccatcaaagtgatggcaggagaa
cctgttagcatccctgcagatgtgacaggacttccaatgcctaagattgagtggtctaag
aatgagaaagtgatagaaaaacccactgatgcacttaaaataaccacagaagaggtatcc
cgaagtgaggcaaagactgagcttagcattgccaaggcagtccgagaggacaaaggcact
tacacagtcactgcttctaatcgccttggatcagtgttccgaaatgttcacattgaagta
tatgaccgtccatccccaccaagaaatcttgctgttactgacattaaagctgaatcctgc
tacttgacatgggatgcccctctagacaatggtggcagtgaaatcactcattatgtcatt
gacaaacgtgacgcaagtaggaaaaaatctgaatgggaggaagtcaccaacactgctgta
gagagaagatttgggatttggaagcttatccccaatggccagtatgagttccgagtcagg
gcagtgaataaatatggaaccagcgatgagtgcaaatcagacaaagttgtcattcaagat
ccttatcgcctccctggacctcctggaaagccacaagtcttggagcgcaccaaaggctca
atgctagtgagctggactcctcctttggacaatggtggctctccgattactggctactgg
ctggagaagagagaagagggtggtgcctactggtcacgtgttagccgagcaccaataacc
aaagtgggattgaagggtgtggaatttaatgttccccgcttgattgaaggagttaaatac
cagttcagagccatggcaataaatgctgcaggaattggccctccaagtgaaccatcagat
ccagctcttgcaggagaccccatatacccacctgggccaccttctcgtccagaggtcaaa
gataaaacaaagtcaaccatctcactagcatggaaacctccagccaaagatggtggcagc
ccaatcaaaggatacattgtagaaatgcaggaagaaggttccactgactggaaaccagtc
aatgaaccagacaaacttatacctacctgtgaatatacggtgcctaatctgaaagaactc
aggaaatataagttcagagtgaaagctgtcaatgaagctggtgaatctgaaccaagtgac
acaactggagagattcctgccactgatgttcaagaggtaccagaggttttcattgacatt
ggagcacaagactgtctggtttgtcaggctggctcccagattagaatccctgctgtcatc
aagggacgcccaacaccaaaatcatcttgggaatttgatggaaaggcaaagaaggcaatg
aaggatggaattcatgacatacctgaagatgcacagctggagactgctgagaactcatca
gtaatcattattccagagtgtaaacggtctcactcaggcaaatacagcatcaccgccaag
aataaagcaggacagaagactgcaaattgcagagttaaagtcatggatgtacctgggcca
cccaaagatctgaaagtcagcgacatcaccaggggtagttgcagactttcgtggaagatg
ccagatgatgatggaggagataggatcaaaggctatgttatcgagaaaaagaccattgat
ggaaaagcctggacgaaagtcaatccaaactgtgggagcacctcatttgtagtgcctgat
ctcatctctgaacagcaatatttcttccgtgtgagagcagaaaaccgttttggagttggc
ccacctgtggaaaccattcagaggaccactgccagagatccaatatatcctcctgaccct
cctattaaactcaagatcggccttataacaaagaacacagtacacctgtcatggaaacct
cctaagaatgatgggggctcccctgtcacccactatattgttgaatgccttgcatgggac
cctaccgggacaaagaaagaggcatggaaacagtgtaataagcgtgatgtggaagaactg
gaatttactgttgaagacctcatcgagggtggggaatatgaattcagagtcaaagctgtc
aatgctgcgggtgtcagcaaaccttcgtccactgttggtcccgtgactgtcaaagaccag
acatgcccaccatcaattgaactaaaagaattcatggaagtcgaggaaggaacagatgtt
aacattgtggccaaaattaaaggtgtgccattcccaacccttacctggtttaaagctcct
ccaaagaagcctgataacaaagaacctgttgtctatgacacccatgtcaacaaactggtg
gtggatgatacttgcactttagttattccacagtctcgcagaagtgacacaggcttatat
accatcacagctgtaaataacctgggaacagcatcaaaggagatgagattgaatgtcctt
ggtcgtcctggccctccagtgggacccataaaattcgaatctgtttcagcagatcaaatg
acaatatcttggcttccgcctctagatgatggtgggtctaagattacaaactatgtaatc
gagaaaagagaagctaacaggaagacatgggtacgtgtctccagtgaacctaaagagtgc
atgtacacaattcccaaattgctggaaggccatgaatatgtattccgaattatggcccag
aataaatacggcattggagagccacttgacagtgaacctgaaacagcacgaaacctcttc
tctgttcctggaccacccgataaaccaacagttagcagtgtgactcgtgactccatgaca
gtcaactgggaagagccagaatatgatggaggctctcctgtgaccggatactggctagaa
atgaaagataccacgtcaaagagatggaagagggttaaccgagatcctatcaaagccatg
actttgggtgtttcttataaagtgactggtcttattgaaggttctgactatcagttccgg
gtatatgcaatcaatgctgctggtgtaggtccagcaagtctcccatcagatccagtgact
gctagagatccaattgctcctcctggccctccatttcccaaagtgacagactggactaaa
tcatctgtggacctagagtggtctcccccattaaaagatggtggatccagagtaactgga
tacattgttgaatacaaggaagaaggaaaagatgagtgggaaaagggcaaagataaagaa
gtgagaggaacaaaacttgttgtgactgacttgaaagaaggcgcattctacaaattcagg
gtgagagcagtcaacattgctggcattggagaacctggagaagtcacagatatcattgaa
atgaaggacagaattgttgtacctgaccttcagctagatgccagtgtcagagacagaatt
gtggtccatgctggaggggtgatccggatcattgcctatgtgtctgggaagcctcctccc
accgtcacctggagcatgaatgaaagagccttacctcaggaagctgccattgagagcaca
gccattagctcatccatggtcattaagaactgccagagaagccatcaaggcgtctattct
ctgcttgccaaaaatgcagggggagaaagaaagaagacaattattgttgatgtattagat
gtgccaggtcctgttggagaaccattcctgtctgacaccctgaccaacgactcctgcaaa
ctgacgtggttttctccagaagatgatgggggctctccaatcaccaactatgtcatcgag
aagcgagaatctgaccgcagagcgtggaccccagtgacatgcacagtcacccgacaaagt
gctgtcgtccagggtctcactgaagggaaatcctactttttccgaatcgcagctgaaaat
agtgtaggcatgggcccatttgttgagacgccaaatgcacttgtcatcagagatccgata
actgtaccagagcgtcctgaagaactgcaagtcaaagaagttactaaagattctgtaact
ttgacttggaaacctcccaaatatgatggtggatccgaaattattaactatgtcctagaa
agccggctcattggaactgagaagttccacaaagttacaaatgacaacttgcttagcaga
aaatacactgttaaaggcttaaaagaaggtgatacctatgagtaccgtgtcagtgctgtc
aatatcgttggacaaggaaaaccatcattttgcaccaagccaatcacttgcaaggatgag
ctggctcccccaacacttgacctggacttcagagataagctcacagttcgagttggtgaa
gcttttgccctcactgggcactactcaggcaaaccacagcctaaggttagttggttcaaa
gatgaagttgatgtgctagaagacgatcgcactcatataaagactactccaacaacactt
gctctagagaagatcaaggcgaaacgttctgattctggcaaatactgtgtagttgtggag
aatagtacaggctccaggaaagggttctgtcaagttaatgttgttgattgtcctgggcca
ccagtaggacccgtccattttgatgaggtgaccaaagagtacatggtcatctcttggaaa
ccacctttagatgatgggggaagtgaaattaccaattatattattgagaaaaaggaggtg
ggtaaagacgtttggatgcctgtgacatctgcctgtgctaaaacaacctgcaaagttccg
aaactgcttgaaggaaaagattacattttccggatatatgctgagaatctgtatggaata
agtgatcctctggtgtctgattcaatgaaagccagagatcgtttcagggttcctgatgca
cctgatcagccaattgttacagaagtcaccaaggactctgcgttagtaacttggaacaag
ccacatgatggaggaaagcctattacaaactacatcctggaaaagaaggaaactatgtct
aaacggtgggctagagttaccaaagaacctatccacccatacactaaatttagggttcct
gatcttctagaaggatgtcagtatgaattccgggtttctgcagaaaatgaagttggcatt
ggagatccaagcccaccatccaaaccagtttttgcaagagatccaattgctaagccaagt
ccacctgttaatcctgaagcaatagatacaacatgtaattcagttgatctaatgtggcag
ccaccacgtcatgatggtgggagcaagatactgggttatattgtggagtaccagaaagtt
ggagatgaagagtggagaagagccaatcacactcctgagtcatgtcctgaaactagttat
aaagtcactggtcttcgagatggacaaacctataagttccgagtgtttgcagtcaatgaa
gctggtgaatcagatccagctaatgttccagaaccagtcctaataaaagacagacttgaa
ccccctgacttgattcttgatgccaacatggcaagagaacaatacattaaagtcggtgat
actctaaggcttagtgctgtcatcaaaggagtgccattcccaaaagtaacctggaaaaaa
ggagacagagaggctccaaccaaggcccaaattgatgttactccagttggtagcaagctt
gaaattcgtaatgctgcccatgaagatggtggaatttattccttaacggtagagaatcca
gctggttcaaaaactgtctcagtgaaagtacttgtattagataaacctgggccacctaga
gatctggaagtcagtgagattaggaaagattcttgttaccttacgtggaaggaaccactg
gatgatggtggctctgtcattacaaattatgtagttgagaggaaagatgttgccagtgca
cagtggtcacctctttcaacaacgtcgaagaaaaagagtcacttggccaaacatctgaat
gaaggcaatcagtacctcttccgagtagctgctgagaaccaatatggacgtggtcctttt
gttgaaacacctaaacccatcaaagctctggatcctctccatcccccagggccacccaag
gacctacaccatgtagatgttgacaagactgaagtctcccttgtttggaataagccagat
cgtgatggtggctctccaatcactggatatttggtggaatatcaagaagaaggtgcccag
gactggactaaattcaagactgtgaaaaacttggagtgtgttgttactggactacagcaa
ggaaagacctatagattccgtgtaaaagctgaaaatatcgtgggtcttggtctccctgat
acaactatcccaatagaatgtcaagaaaaactagtgcctccgtctgtggagctagatgtg
aaattaattgaagggcttgtggtaaaagctgggaccactgtcagattccctgctatcata
agaggtgtacctgttcctactgcaaagtggacaactgacgggagtgagattaaaacggat
gaccactacacagttgaaactgatagttactcatccgtgcttaccattaagaactgctta
aggaaagacactggggaatatcaaatcacagtttccaatgcagccggtaccaaaaccatg
cccgtacatctcactgttcttgatgttcccggtccaccaacaggtcctattaatcttctg
gatattacccctgaatatatgactatctcatggcagccacctaaggatgatggaggaagc
cctgtgataaattatattgttgagaaaaaagatacaagaaaagacacatggggtgttgtc
tcttcaggaagcagtaagatgaagctgaaaataccacacttgcaaaagggctatgaatat
gttttccgagttagagcagagaataagatgggtgttggtcctccccttgactccacacct
accgttgccaaacataagtttagtcctccatctcctcctggtaaaccagtggttacagac
attactgaaaatgctgcaacagtgtcttggaccctgccaaagtctgatggtggcagtcca
ataaccgggtactacatagaacgtcgagaaataactggcaagtgggtgagggtcaacaaa
acacctatcgctgacctgaagttcagggtgactggactctatgaaggaaatacatatgag
tttagagtttttgctgaaaatcttgcaggactaagcaatccgtctccaagttctgaccca
ataaaagcttgtcggcccatcaaaccacctggaccaccaattaatcctaaactgaaagac
aagagcagagaaacagctgacttggtgtggacaaagcctctcagtgatggtggtagcccc
attctaggatacgtagtggaatgtcagaaacctggcacagcacagtgggacaggattaac
aaagatgaactcattagacagtgtgcctttagggtgcctgggctaattgaaggaaatgag
tacagattccgtataaaggcagctaatattgtgggtgagggagaaccaagagaactagca
gaatccatggttgcaaaagatatccttcatcctccagaagtagaacttgatgttacttgt
cgtgatgttattactgttagagtgggccaaactatccgcattcttgctcgagtcaaaggc
agacctgaaccagatataacttggtctaaggaaggcaaagtattaactcgagataagcgg
gttgatctaattcatgatctgccacgtgttgagttacaaattaaagaagctgttagaagc
gatcatggcaagtatatcatctcagctaagaacagcagtgggcatgcccaaggttcagcc
attgttaatgtccttgacagacctggaccttgccagaatttgagagttagcaatgtaacc
aaagagaactgcacactttcttgggaaaacccacttgacaatggtggctcagaaataacg
aatttcatagtagaatatcgtaaaccaaaccagaaaggctggtcaattattgcttcagat
gtcaccaagagattaatcaaggccaaccttttagcaaacaatgaatactatttccgagtt
tgtgcagagaataaagtaggtgttgggccaaccactgaaacaaaaactccaattctggcc
attaacccaattgacagaccaggtgagcctgaaaaccttcatattgcagataaaggaaag
acatttgtgtatctaaagtggcggcggcctgattatgatggtggcagcccaaatctgtca
tatcatgtcgagaggaggctgaagggctgtgctgactgggaaagagtacacaaaggaagc
attaaagaaacccactacatggttgacaaatgtgttgaaaaccaaatttatgagttcaga
gtgcaaacaaagaatgaaggtggagaaagtgattgggtaaagacagaggaagttgttgtg
aaggaagacttacagaaaccagtacttgatctgaaattaagtggcgtgctaactgtcaaa
gcaggggacaccatcagacttgaggcaggtgttagaggcaaaccatttccagaagttgta
tggaccaaggacaaagatgctacagatttaacaagatcaccaagggtcaagattgatacc
ggtgctgattcatctaaattctctcttagcaaagcaaggcgaagtgacggtggtaaatat
ataattacagcaacaaacacagctggcagttttgtggcctttgccactgtcaatgtttta
gataagcctggtcctataagaaatctgaaaatcactgatgtgtccagtgatagatgtact
attcgctgggatccaccagaagatgatggtggctgtgaaatccaaaattacattctagaa
aaatgtgagagcaagcgaatggtttggtctacctattctgctactgtcttgacgcctggt
actaccgtaacacgtctcatagaaggaaatgaatatattttcagagtccgtgcagaaaat
aaaataggcacagggcctccaacagaaagtaaaccagtcatagcaaaaaccaaatatgat
agacctggtcgccctgatgccccagaagtcactaaaataagcaaagaagaaatgactgtg
gtttggaatccacctgaatatgatggtggaaagtctatcacaggatactatttggagaaa
aaagaaaaacatgcggtacgatgggttcctgtaaacaagactgcgatccctgagagacgt
atgaaagtacagaatctcctcccaggacatgaatatcagttccgtgtcaaggcagaaaat
gaaattggcattggagaaccaagcttaccatcaagaccagtggtggcaaaagatcccata
gaaccacctggtcctccaaccaatctgaaagtggttgatacaacaaaacactccataact
cttggatggggaaaaccagtctacgatggtggtgcaccgataattggatatgttgtagaa
atgagacccaaaatagcagatgcatcacctgatgaaggctggaaaaggtgcaatgctgca
gcacaactcgttcgcatggaattcaccgttaccagcttggatgaaaaccaggaatatgag
ttccgggtgtgtgcccaaaatcaagttggcattgggcgcccagcagagctaaaggaagca
atcaagcctagagaaatcctagaacctccggagattgatttggatgccagtatgaggaag
ctggtcatagtgagagcaggatgccccatccgactatttgcaatagtgagagggcggcca
gcccccagagtcacttggcgaaaagtgggtatcgacaatgtggtcagaagaggacaagtc
gatctggttgacactatggccttcctggtcatccccaattctacccgtgatgactcagga
aaatattccttaacactggtgaacccagcaggagaaaaggctgtgttcgtgaatgtcaga
gtattggatactcctggacctgtatctaatttaaaagtttcagatgtcacaaaaacatca
tgccatgtgtcctgggcccctcctgaaaatgatggtggtagccaagtgacacattatatt
gtggagaaacgtgaggcagagagaaagacgtggtcaacagttactccagaagttaagaaa
acgagcttccacgtgtccaatcttgtccctggcaatgagtacttcttcagagtaactgct
gtcaatgagtatggccctggtgtcccaacagatatcccgaaaccagtgcttgcatcagat
cctctaagtgagccagatcctccaagaaaactagaagtgactgaaatgacaaagaacact
gctgcgttagcgtggttacctcccctgcgtgatggaggggcaaaaattgatggctatatc
atcagttacagagaagaggaccagcctgaagatcgctggacagagtactcagtggtaaag
gatctcagcctcgttgtctctggtttaaaggaaggaaagaaatataaatttagagtagca
gccagaaatgctgttggagtcagcttgccaagagaagccgaaggagtatatgaagccaaa
gaacaactgttgccaccaaagatccttatgccagagcagattactattaaagctggaaag
aaactccgcatcgaagcctatgtgtatggaaaacctcatcccatctgtaaatggaaaaaa
ggagaagatgatgttgtcacatctagccacctggtggtgcacaaaacagacaactcttct
gttctgatcataaaagatgttactaggaaagacagtggttactatagcctcacagcagag
aacagctctggaacagacactcagaaaatcaaagtcattgtcatggatgcgccaggaccc
cctcagcctccatttgacatttctgatatcgacgccgatgcttgctccctgtcatggcac
atccctctggaggatggaggcagtaacatcaccaattacatagtggagaagtgtgatgtg
agccgaggggactgggtcacggctctagcttcggtcacgaaaacttcttgcagggttgga
aagctgatcccaggccaggagtatatgttccgggtccgtgctgaaaatcgatttggaatt
tcagagcctctcacatctccaaagatgcttgctaagttcccatttggtgtgcctagtgaa
ccaaagaatgcacgagtcactaaagtcaacaaagactgcatatttgtcgcatgggacaga
ccagacagtgatggagggagccctattactggttacttgattgaacgcaaagagagaaac
agtttactctgggtgaaagctaacgacactgctgtccggtcaactgaatttccttgtgct
ggccttgttgaaggtcttgagtattcattcagaatctacgccctaaacaaagctggatcc
agccctcccagcaaaccaacagaatatgtaactgcaagaatgccagttgatcctcctggg
aaacctgaagttactgatgtcaccaagagttctgcatcccttatctgggcccggcccaag
catgatggaggaagcaaaattattggctattttgtagaagcttgtaaacttcctggtgat
aagtgggtgcggtgcaatactacacctcaccagattccccaggaagagtacacagctact
ggcttagaagagaatgctcagtatcaatttagagcaattgctaagactgcagtaaacatc
agccccccttctgaaccttctgacccagtgaccatccttgcagagaatgttcctcccagg
atagacctgagtgtggctatgaaatctttgctcactgtgaaagctggaactaatgtctgc
ttggatgctaccgtttttggtaaaccaatgccaactgtttcttggaaaaaagatggcact
ccagtgaaaccagcagaaggcatcaagatggccatgcagcggaacctgtgtaccttggag
ctattcagtgtgaaccgaaaggactcaggagattataccattactgctgaaaattcaagt
ggttccaaatcagccaccatcaagcttaaagtattagataagccaggtcctccagcatct
gttaagatcaacaaaatgtattcagatcgtgcaatgctttcttgggaacctcctcttgaa
gatggaggttcagaaatcaccaactatattgtagataaacgtgaaacaagcaggcccaac
tgggctcaagtctcttctactatacccatcaccagctgtagtgtggagaaacttatagag
gaccatgagtatcagttccgtatctgtgctgaaaataaatatggagtgggtgatccaatc
ttcactgaaccagcaattgctaaaaacccatacgatccacctggacgctgtgatcctcct
gttattagcaacataaccaaagatcacatgacagtcagctggaaacccccagcagatgat
ggtggctcacccatcactggctatttgcttgaaaagcgggaaatgcaggcagttaactgg
actaaggtcaacagaaaacctgtgatagaaagaacaataaaagcaacaggtctccaagaa
ggtactgaatatgagttcagagtcacagctataaataaagctggaccaggcaaacccagt
gacgcctccaaagctgtgtatgctcaggatcctctgtaccctcctggcccaccagctttc
cctaaagtatatgatacaacgcacagctccgtgagtctatcttggggcaagccggcttat
gatggtggtagccctatcatcggttatcttgttgaagtaaaacgagtcgactctgatcac
tgggtgaggtgcaatttaccagagaagctccagaaaatgcgctttgaagttactggcctg
attgaaaacacagaatatcagttccgagtgtatgctgttaataagattggatacagtgac
cccagtgatgtgccagataagcactgccccaaggacatcttaattccacctgagggagag
cttgatgctgaattacggaaaacactcatattacgtgccggagttacaatgagactctat
gtgccagtgagaggacggccacctccaaagattacttggtccaaaccaaatgtcaattta
agagaaaggattggactggacataaagtcaactgactttgacactttcttgcgctgtgaa
aatgtgaacaaatatgacgcaggaaaatatatcttaaccctagagaacagctgtggcaaa
aaggaatacaccattgtggtgaaagtgcttgatactcctggacctcctgtcaatgtgact
gtaaaggaagtatccaaagactcggcttatgtcacctgggatcctcccattattgatggt
ggaagccccattataaactatgtggtagaaaaacgtgatgccgagaggaagtcctggtct
acagtaacaactgagtgctcaaaaacaagcttcagagtatctaacttggaggaggggaaa
tcctactttttcagggtatttgctgaaaatgagtatggcattggtgaccctggtgaaacg
cgtgatgctgtcaaagcttctgaaacccctggaccagtcgtggacctgaaagcactgtct
gtaactaagtcatcttgcaccattggctggaagaagcctcgcagtgatggcggaagtcga
attactggatatgcagtcgatttcctgactgaagataataagtggcaacgagttatgaaa
tcattaagcctacagtataccacaaaagatttgagtgaagggaaggaatataccttcaga
gtgtgcgctgagaatgacaatggagaaggtaccccaagcgaagtcacagttatggcaaag
gatgacgtcgtggctcctgatcttgacttaaaggatctacctgatttgtgctatttggct
aaagaaaacagcaacttccgtcttaagatccccataaagggcaagccagcaccatcagta
tcctggaagaaaggagaagatcctctagcaactgacacaagagtcagtgttgagtcaact
gcagttaacacgactcttgtagtatatgattgccaaaaatctgatgctggaaaatacaca
atcacgcttaagaatgttgctggcaccaaagaaggaacgctttctataaaagttgttggc
aaacccggtatccctactggaccaatcaaatttgatgaagtcacagcagaagccgtgacc
ttaaagtgggctcctccaaaggatgatggaggttctgaaatcaccaactatatcctggag
aagagagattctgtgaataacaagtgggtgacatgtgcctctgctgtccagaaaactacc
tttagagtaacaagacttcatgagggaatggaatataccttcagagtcagtgctgaaaat
aagtatggtgtaggtgaaggcctgaaatcagagccaattattgctaaacatccatttgat
gtgcctgatgctcctccacctcctaatattgtagatgttaggcatgattcagtatctctt
acttggactgaccccaagaagactggtggctctccaattacaggatatcacattgagttc
aaggaaagaaacagccttttgtggaagagagctaacaagactccaataaggatgaaagac
tttaaagtgacaggattaactgaaggtcttgaatatgaattccgagtcatggccatcaat
ttagcaggagtgggcaagccaagcctgccatcagagccagttgtggcacttgatccaatt
gatcctcctggcaaacctgaggttattaatgtaacaagaaattcagtaactctcatatgg
actgaacccaaatatgatggtggtcataagttaaccggatatatagtggagaagcgggat
ctgccttctaagtcttggatgaaagccaaccatgtaaatgtccctgactgtgcttttact
gtaactgaccttgttgagggtggaaaatatgaattcagaattagggcaaagaatacagca
ggtgctatcagtgctccatctgaaagtacaggaaccatcatttgcaaggatgaatacgag
gcaccaaccattgtccttgaccccacaataaaagatgggctaacagttaaagcaggggaa
actattgttttgagtgccattagcattcttggcaaacctcttccaaagtcaagttggtcc
agggcagggaaagacatcagaccatcagatatctctcagataacttcaaccccaacatct
tccacacttacagtcaagtattctagtagaaaagatgccggtgaatatacaatcactgct
accaatccttttgggacaaaggaggaacatgtgaaagtaacagtccttgatgtacctggt
cccccgggtcctattgaaatcagtaatgtttctgctgaaaaagcaacacttacatggaca
cctcccttggaagatggtggatcaccaattaagtcctatgttcttgaaaagagagaaacc
agcagacttttgtggacagtggttgctgaagatattcagtcttgcaggcatgtggtaacc
aagcttatccagggaaatgagtacatcttccgtgtctcagctgtaaaccactatggcaaa
ggagaacctgtacagtctgaacctgtcaaaatggtagacagatttggtcctcctggccct
cctggaaaaccagagatatcaaatgtcactaagaatactgccacagtcagttggaaaaga
ccaactgatgatggtggcagtgaaattacaggatatcatgtagaaaggagagaaaagaaa
ggcttgcggtgggtgagagcaacaaagacaccagtctcagatctcagatgcaaagtaaca
ggactgcaagaaggaaacacctacgagttccgtgtcagtgctgaaaacagagcaggaatt
ggcccacctagtgatgcttcaaatcctgttttaatgaaagatgcagcatatcctccagga
ccaccttcaaatccacatgtcactgatactaccaagaaatctgcttctttagcatggggc
aagcctcactatgatggtggacttgaaatcacaggctatgtggtagagcatcaaaaagta
ggagatgaagcctggataaaagatacaacaggagctgccctcagaatcactcagtttgtt
gtccctgatcttcagactaaagaaaaatacaattttagaatcagcgctgtcaatgatgca
ggtgttggggaaccagcagtgattccaaatgttgaaattgtagagcgggaaatggttcct
gattttgaactggatgctgagcttcgaagaacacttgtggttagagcaggactcagtatt
agaatttttgtgcccattaaaggtcgtcctgctcctgaagtgacatggaccaaagatggc
gtgaacatgaaaaatcgagccaatattgaaaatacagaatcatttactcttttgattatc
ccagaatgtaacagatatgacactggaaaatttgtgatgaccatcgaaaacccagctgga
aagaaaagtggctttgttaatgtcagagtcttggatacaccaggccctgtccttaactta
aagccaacagacatcaccaaggacagtgtcaccctgcactgggacctgcctctgattgat
gggggctctcgtataacaaactatattgtggagaaacgggaagcaacacggaaatcttat
tctactgtcaccactaaatgccataaatgcacatataaagttactggcttgtctgaagga
tgtgaatacttcttcagagtaatggcagaaaatgaatatggaattggtgagccaacagaa
accacagaacctgtaaaagcctccgaagccccatcacccccagacagccttaacattatg
gacataactaggagcacagtcagcttggcatggcccaaacccaaacatgatggtggcagt
aagatcaccggctatgtaattgaagcccaaagaaaaggctctgaccaatggagccacatc
acaaccgtaaaagggttagaatgtgttgtgaagaatctaacggaaggggaggaatatacc
ttccaagtgatggcagtgaacagtgcgggaagaagtgcccctagagaaagcagacctgtc
attgtgaaggagcagacaatgcttccagagctggacctccgtggcatctatcagaaattg
atcattgccagagctggtgaaaacatcaaagttgaaattccagtgcttggtcgaccaaag
cccacagttacttggaaaaaaggagaccaagttcttaaacagacacagagagtcaatgtt
gaaaatacagcaatgtcaaccatcttaaatatcaatgagtgtgtcagaagtgatagtggg
ccctatccattaacagcaaagaatattgtaggagaggttggagatgtcatcaccattcaa
gttcatgacatcccagggccacctactggaccaatcaaatttgatgaagtttcatctgac
tttgtaactttctcttgggacccacctgagaatgatggaggcgtaccaataagcaactat
gtggtggaaatgcgacagactgatagtactacatgggtagagttagcaaccactgttata
cgtactacttataaggccactcgccttactactggagtggaatatcaattccgtgtaaaa
gctcaaaacagatatggagttggaccaggcatcacatcagcatctgtagttgccagctat
ccatttaaggtacctggacctcctggcacccctcaggtaactgcagttaccaaagactca
atgacaatcagctggcatgagccactttctgatggtggaagccccattttaggatatcac
attgaaagaaaagaaagaaatggtattcagtggcagactgtgagcaaagcattagtacca
ggcaatattttcaaatccagtggacttacagatggcattgcttatgaattccgagtaatt
gcagaaaatatggcaggtaaaagcaagccaagcaagccatctgaaccagtgtttgctttg
gatcccattgacccacctgggaaaccgatacctctaaatattactagacacacagtggca
cttaaatgggctaagcctgaatatactggaggctttaaaattactagttacatagttgaa
aagagagaccttccaaatggacggtggctgaaggccaacttcagcaacattttggagaat
gaatttacagtcagtggcctaacagaagatgctgcatatgaattccgtgtaattgccaaa
aatgctgctggtgctatcagcccaccgtctgagccatcagatgctatcacatgcagggat
gacattgaagcaccaaggataatggtggatgttaaatttaaggacacagttatattaaag
gcaggtgaagcattcaagctagaagctgatgtttcaggtcgcccacctccaacgatggaa
tggaccaaggatggaaaagagcttgaaggcacagcaaaattagaaataaaaattgcagat
ttctccactcatctcataaacaaggattcctctagaaaggatagtggtgcctatatcctc
acagcaactaatcctggtggctttgccaagcatattttcaatgtcagagttcttgataga
ccaggcccacctgaaggacctttagctgtatctgatgtgacagcagaaaaatgtgtgttg
tcatggttgcctcctctggacgatggaggtgccaaaattgaacattacatagtacagaaa
cgtgaaaccagcagattggcatggacaaatgtcgcctctgaagtccaagtaacaaaactg
aaggtcactaaacttttgaaaggcaatgaatacatattccgtgtcatggctgtaaataaa
tatggagttggagagccactggaatcagagcctgtgcttgcagtggatccttatggacct
cccgatccacccaaaaaccctgaagttacagctattactaaagattccatgattgtctgc
tggggacatcctgactctgatggtggaagtgaaatcataaattatattgtggaacggcgt
gataaagctgggcaacgctgggtgaaatgcaacaaaaaaactcttactgatttaagatat
aaagtgtctggactgacagaaggacatgaatatgagttcaggattatggcagaaaatgct
gctgggattagcgcaccaagttctaccagtccattctataaagcttgtgacgctgtgttt
aaacctggcccaccaggtaacccacgtgttcttgatacaagcagatcatccatttctatt
gcatggaataaacctatctatgatggtggttcagaaatcactgggtacatggttgagatt
gccctgccagaagaagatgaatggcaaattgtcaccccaccatctggactcaaggcaact
tcttataccatcactggcctcatagagaaccaggaatataaaatccgcatctatgccatg
aattctgaaggtcttggggaacctgcccttgtccctggaacgccaaaggctgaagacaga
atgctgccaccggagattgaattggatgctgacctgcgcaaagttgttactataagagcc
tgctgcaccctaagactttttgttccaatcaaaggaaggcctgcacctgaggtgaagtgg
gcccgggaacacggagagtctttggataaagctagcattgaatccacaagctcttacacc
ctgctcattgttggaaatgtaaacagattcgacagtggcaaatacatactgactgtagag
aacagctcgggcagtaagtctgcattcgtcaatgttagagtattagatacaccaggccct
ccacaggatctgaaggtgaaagaggtcacaaagacatctgtcacattgacatgggagcct
cctcttcttgatggaggatcaaaaataaagaactatattgttgaaaagcgggaatcaacg
agaaaagcatattcaactgttgcaacaaactgccacaagacttcctggaaggtagaccag
cttcaagaaggctgtagttactatttcagggttcttgctgaaaatgaatatggcattggg
ctgcctgctgaaaccgcagagtctgtgaaagtatcagaacgacctcttcctccaggaaaa
atcactttggtggacgtcacaagaaacagtgtgtcgctctcttgggagaaaccagagcac
gatggaggcagccgcattttaggctacattgtagagatgcagagcaaaggcagtgacaaa
tggaccacttgtgccacagtcaaagtcacagaagccactataactggactgatccagggt
gaagaatactctttccgtgtttcagctcagaatgaaaagggcatcagtgatcccagacaa
ctgagtgtgccagtaattgccaaagatcttgtcattccaccaaccttcaaactcctgttc
aacactttcactgtactagcaggtgaagaccttaaagttgatgttccattcattggacgc
cctacaccagctgtaacctggcataaagatgatgtaccactgaagcagacaactagagta
aatgcagagagcacagaaaataattcactactgacaataaaggaagcctgccgagaagat
gttggacattacatagttaaactgactaattcagctggtgaagctactgaaactcttaat
attattgttcttgacaaaccagggcctccaactggaccagttaaaatggatgaagtgaca
gctgatagtattactctttcctgggaaccaccaaagtacgatggtggaagttctatcaat
aattacattgtagagaagcgggacacctccacaaccacttggcagattgtgtcagctaca
gttgcaaggacaaccataaaggcctgcagattaaagaccggatgtgaatatcagtttagg
attgcagctgaaaacagatatggaaagagtacttacctcaattcagagcctattgttgcc
cagtatccattcaaagttcctggtccacctggcacaccattcgtgacattctcctccaag
gacagcatggaagtgcaatggcatgagccagtcagtgatggaggaagcagagttattggc
tatcatctagaacgcaaggaaagaaatagcatcctctgggtcaaattgaataaaacaccc
attcctcaaaccaagtttaagacaaccggccttgaggaaggcattgagtatgagtttaga
gtctctgcagaaaacattgtgggcattggcaagccaagtaaagcatcagaatgctatgta
gctcgtgacgcatgtgatccaccaggacgaccagaggcaatcattgtcaccaggaattct
gtgactctccagtggaagaaacctacctatgatggtggaagcaagatcactggttatata
gttgagaagaaagagttacctgagggccgctggatgaaagccagtttcacgaatatcatt
gacactcaatttgaagtaactggcctaattgaagatcatagatatgagttccgagttata
gctcgaaatgccgcaggagtgtttagtgagccttcagaaagcacaggagcaataacagca
agagatgaggtagatccaccaagaataagtatggaccccaaatacaaagacacagttgtg
attcatgctggtgagtcattcaagattgatgcagatatacatggcaaaccgataccaacc
actcagtggataaaaggtgatcaggagctttcaaacacagctcgattagaaataaagagc
actgactttgccaccagtctcagtgtaaaggatgcagcacgtgttgacagtgggaattac
attctgaaggccaaaaatgttgcgggagagagatcagttactgtgaatgtgaaagttctt
gatagaccaggcccacctgaaggacctgttggtatatcaggggttacagcagaaaaatgc
acattagcctggaaacccccacttcaagatggtgggagtgatatcacaaattatatagtg
gaaaggcgagaaaccagccgtctagtctggactgtggttgatgccaatgtgcaaactctc
agctgcaaggttactaagcttcttgaaggcaacgaatatattttccgtataatggctgta
aacaaatatggtgttggtgaaccacttgaatctgaaccattgattgccaagaatccattt
gtggtaccggatgcaccaaaagctccagaagtcacaacagtgaccaaggactcaatgatt
gttgtatgggaaagaccagcatctgatggtggcagtgaaattcttggatatgttcttgaa
aaacgagacaaagagagcattcgctggacaagatgccacaagcgtctgattggagagttg
cgcttgagagtaactgggcttatagagaatcacaattatgaattcagagtctcagctgag
aatgccgctggccttagtgagccaagccctccttctacataccaaaaagcttgcgatcct
atttacaaaccaggtcctccgaacaaccccaaagtcatggatatcaccagatcttcagtt
ttcctttcctggagcaaaccaatatatgatggtggctgtgaaatccaaggatacattgtt
gaaaaatgtgatgtgagtgttggtgaatggacaatgtgcactccacctactggaatcaat
aaaacaaatatagaagtagagaagcttgtggaaaagcatgaatacaacttccgtatttgt
gctattaataaagctggagttggtgaacatgctgatgtccctggacctgtagtagttgaa
gaaaaattggaagcaccagacatagatctcgacctagaactaaggaaagttataaatgta
agggcaggtggctctttaaggctatttgttcctataaaaggtcgtcctaccccagaagtt
aaatggggaaagatggatggtgaaatccgagatgcagctataattgatgtcactagcagt
tttacctctcttgttcttgacaatgtcaaccgatatgacagtgggaaatatactctaaca
ttagagaacagcagtggaatgaagtctgcctttgttactgtgagagtcctggatacgcca
agtccacctattaacctgaaagtcacagaaatcaccaaagactcagtgtcgattacatgg
gaacctcctttgttagatgggggatctaaaatcaaaaattacattgtggagaagcgtgaa
gccacaagaaaatcatatgctgctgttgtaacaaattgccataagaattcttggaaaatc
gatcaactccaagaaggctgcagttattactttagagtcacagccgagaatgagtatggt
atcggccttcctgctcacactgctgatccaattaaggttgcagaagtcccacagcctcca
ggaaaaataactgtggatgatgtgaccagaaacagtgtctctctgagttggacaaaacct
gaacatgatggtggcagtaaaatcattcaatatattgtggaaatgcaagctaaacacagt
gagaagtggtcagagtgtgctcgggtaaagtcccttgaggcagtaataaccaacctaact
cagggagaagaatatctttttagagttgttgctgtaaatgaaaagggaagaagtgatcct
aggtcccttgcagttccaataatcgccaaagatctggttatagagccagatgtaagacct
tcattcagcagttacagtgtacaggttggccaagatttgaaaatagaagtaccaatttct
ggacgtcctaagccaactattacctggactaaagatgatcttcctctgaagcagaccaca
agaatcaacgtgaccgattcacttgacctcaccacactcactattaaagaaactcacaaa
gatgacagtggattctatggaatcacagttgccaatgttgttggtcagaaaacagcatcc
attgaaattataactctagataaacctgatcctccaaaaggacctgttaaatttgatgaa
gtcagtgctgagagtgtcacattatcttggcagcctccattatatacagggggctgccag
attacaaactacattgttcagaaaagagacacaaccaccacagtatgggatattgtttct
gccactgttgctagaactacactcaaagtaaccaaactgaaaactggtacggaataccaa
ttcagaatatttgctgaaaacaggtatggacaaagctttgccttggagtcagaaccagtt
gtggctcaatatccctacaaagaaccaggccctccaggtacaccatttgccgtatccatt
tccaaagactctatggtcatacagtggcacgaaccaatcagtaatggtggcagccctatc
ataggttaccaccttgagagaaaggaaagaaatagtattttgtggacaaaagtcaacaaa
actattattcatgacacccagttcaaagtgctaaatcttgaagaaggcattgaatatgaa
ttcagagtttatgctgaaaatattgttggtgtaggcaaaccaagcaagaattctgaatgc
tatgtagcccgagatccctgtgacccaccaggaaccccagaaccaataatagttaaaaga
aatgaaatcactttacagtggaccaaacctgtgtatgatggtggaagtatgattacaggc
tacattgtagagaaacgtgacttacctgagggtcgctggatgaaagctagtttcacaaat
gtcatcgaaactcaatttactgtgtcaggtctcactgaagatcaaagatatgagttcaga
gtcattgcaaagaatgcagctggtgcagtaagtaaaccttctgacagtactgggccaata
actgccaaggatgaggttgaactcccaagaatttcaatggatccaaaattcagagacaca
atagtggtaaatgctggagaaacattcaggcttgaggctgatgtctatggaaagccccta
cctaccattgagtggttacgaggtgataaagaagttgaagaatctaccagatgtgaaata
aagaacacagatttcaaggctttacttattatgaaggatgccattagaattgatggtgga
cagtatatcttaagagcctccaatgtggcaggttctaagtccttcccagtaaatgtaaaa
gtattagatagaccaggaccaccagaagggccagttcaggttactggagttactgctgac
aaatgcactttagcatgggctccgccacttcaggatggtggcagtgacatttctcactat
gttgtggaaaagcgagaaaccagtagacttgcatggactgtagttgcttcacaagttgtg
actaattctctgaaaattaccaaactcctagaaggcaatgaatatattttccgtataatg
gctgtcaataaatatggtgttggagagcctttggaatctgcaccagtactaatgaaaaac
ccatttgtgcttcctggaccaccaaaaagcttggaagtcacaaacgttgccaaagattct
atgactgtctgttggaaccgtccagatagtgatggtggaagtgaaattattggttacatc
gtagagaaaagagacagaagtggcattcggtggataaaatgtaataaacgccgcattaca
gatttgagactgagagtaacaggattaactgaagaccatgagtatgaattcagagtctct
gctgaaaacgctgctggagttggagaaccaagtccagctaccatttattataaggcttgt
gatcctgtgttcaaacctggcccacccaccaatgcacacattgttgacaccactaaaagt
tcaattacacttgcctggggtaaacccatctatgatggtggcagtgtggtcctgggctat
gtcatagagatctgtaaagcagatgaagaagaatggaaaatagttactccacagactggc
ctgagagtcactcgatttgaaatctcaaaactcattgaacaccaagaatataaaatacga
ctctgtgccctcaacaaagttggtttaggtgaggctgcgtcagttcctggtactgtgaaa
ccagaagataaacttgaagctcctgaacttgaccttgactctgagttaaggaaaggaatc
attgtaagagctggtggatctgccagaattcatattccattcaaaggtcgcccaacccct
gagatcacttggtctcgagaggaaggtgaattcacagataaggttcaaattgaaaaggga
gtaaactatacccaactatcaatagataactgtgatagaaatgatgctgggaaatacatt
ctcaagttggaaaacagcagtggatccaagtctgcttttgtaactgtgaaggttcttgac
accccaggaccaccacagaatttgacagtcaaagaaatcagaaaagattctgttcttctg
gtatgggaaccacccattattgatggaggggcaaaggttaggaactatgttattgataaa
cgtgaatcaaccagaaaagcatatgctaatgtgagtactaagtgcaacaaaacgagcttt
aaagttgagaaccttacagaaggagccatttattactttagagtcatggctgagaatgaa
tttggagttggcattccagtggaaaccacagatgctgtgaaagcttctgaacctccttcc
ccaccaggaaaggtcacactcactgatgtgtcccagaccagtgcagcccttatgtgggag
aagcctgaacatgatggtggaagcagaatactgggctatgttgttgaaatgcagcccaaa
ggaactgagaaatggagtgttgtggctgaatccaaagtctgtaatgctgttgttactggc
ttgagttctggacaagaataccagttccgtgtcaaggcttataatgagaaaggaaaaagt
gatccaagagtgcttggtgttcctgtcatagccaaggacttgactatacagcctagtttt
aagttaccatttaacacatatactgtccaagctggagaagacctcaaaatagaaattcct
gtcattggccgaccaagacctaaaatttcttgggtcaaagatgatgaacctcttaaacag
accacaagagtaaatgttgaagaaacagctacttcaactattttacatattaaagaaagt
agcaaagatgactttggaaaatacaccataacagcaacaaatagtgcaggcacagcaaca
gaaaatctcagcattattgttttagaaaagcctggacctccaattggaccagtgaagttt
gacgaagttagttcagacttcgtggtcatatcttgggaacctccagcctatactggtggc
tgccaaataagtaactacattgtagagaagcgagatacaaccaccaccacttggcacgta
gtatcagcaacagtggcaagaacaacgattaaaataaccaaactgaaaacaggcagtgag
taccagtttagaatttttgctgaaaacaggtatggaaaaagtacctctctggactctaaa
ccagttattgtacaatatccatttaaagaacctggaccacctggaactccttttgtgaca
tcagtctcaaaagatcaaatgcttgtggaatggcatgagccagttaatgatggaggcagc
aaagttattggctaccatcttgaacagaaggaaaaaaacagcattttatgggtcaagttg
aataagacccccattcaagacaccaaattcaaaacaactgggcttgatgaaggccttgaa
tatgagttcaaagtttctgctgaaaatattgttggtattggcaagcctagcaaagtatca
gaatgttttgttgctcgtgatccctgtgacccacctggtcgtcctgaagccattgttatt
acaagaaacagtgtcacactgaaatggaagaaacctgcctatgatggtggtagcaaaata
acaggttatattgtagaaaagaaagacctacctgatggccgctggatgaaagccagcttt
accaatgtattagaaactgaatttacagtgagtggacttgtagaagaccaaagatatgaa
tttagagtaattgcaagaaatgcagctggcaacttgagtgaaccatctgaaagtagtggt
gccattactgcaagggatgaaattgatgcaccaaacgcctcactggatccaaaatataaa
gatgtcatcgttgttcgtgcaggagagacttttgttcttgaagctgacatccgtggcaaa
cctatacctgatatcatttggtcaaaagatggaagagaacttgaagaaacagctgctaga
atggaaattaaatctactattcagaaaacaactctcattgtcaaagattgtatacggact
gatggagggcaatatattctgaaactcagcaatgttggtggtacaaaatctataccaatc
actgtaaaggtgcttgacaggccaggccctcctgaagggcctctgaaagtttctggagtt
actgccgaaaaatgttacctggcctggaacccacctctgcaagatggtggtgctaatatt
tcacattacatcattgaaaagagagagacaagcagactctcctggacccaggtttcaact
gaggtgcaggcccttaactataaagtcaccaaacttctccctggtaatgagtacattttc
cgtgtcatggctgtgaataaatatgggattggagagcccctggaatccgagcccattaca
gcttgtaatccttataagctaccaggtcctccttcaacacttgaagcctcggcaatcacc
aaagattctatggtagtaacatgggcacgcccagtagatgatggaggtgctgaaattgag
ggctacattcttgaaaaacgagataaagagggtgttcgatggaccaagtgcaacaagaaa
acactaacagatctgcgattcagggtaactggacttactgaaggtcatgcctatgaattc
agagttgccgctgagaatgcagctggtgtgggcgaacctagtgagccatctgtcttctac
cgtgcatgtgatggcttgtatccaccaggtccaccaagcaatccaaaagtgacagacact
tccagatcttctgtctccctggcatggaataagccaatttatgatggtggtgcacccatt
aaaggctatgttattgaggtcaaagaagccactgcggatgaatggacaacttgcactcca
ccaacaggattacaaggaaagcagttcacagtgaccaagcttaaagaaaatactgaatat
aacttccgtatctgtgccctcaattctgaaggtgtaggtgaacctgcaactatacctggt
tctgttgttgctcaagagaggacagagccaccagaaatagaacttgatgctgacctcaga
aaggtggtcattcttcgtgccagtgctactttacgcttatttgtcactatcaaaggtcga
ccagaacccgaagttaaatgggaaaaggctgaaggggttctcactgagagggcccagatt
gaggtgaccagctcatacaccatgttggtgattgataacgttaccagatttgacagtggt
cggtacaacctgacgcttgaaaataacagtggctccaaaacagcttttgttaatgtcaga
gttcttgattcaccaagtgctcctataaatttgaccataagagaagtgaagaaagactca
gtgacagtgtcctgggaaccaccacttattgacggtggagccaagattacaaactacatt
gttgaaaagcgagaaactacaaggaaagcctatgctactattacaaacaactgcactaag
aatacatttaaaattgaaaatctacaagaaggatgttcttactacttccgagtcttggct
gccaatgaatatgggattggtttgccagctgaaacaactgaacctgttaaagtgtccgaa
ccacccctcccaccaggaagagtaactcttgtggatgtgacccgtaatacagctacaatt
aagtgggagaaaccagaaagtgatggtggcagcaaaattactggttatgtggttgaaatg
cagactaaaggcagtgaaaaatggagcacttgcacacaagttaagactctagaagcaact
gtatctggcctaactgctggagaagagtatgtcttcagggtagctgcagttaatgaaaaa
ggaagaagtgatccaagacaacttggagtgccagtaattgcaaaggatatagaaataaaa
ccttcagttgagcttcccttccacactttcaatgttaaggctagagaccaactcaagatt
gatgtaccattcaagggaagacctcaagctactgtaagctggaaaaaagatgatcagact
cttagagagacaactagagtcaatgtttcttcttcaaagactgtcacaacactgtgtatt
aaagaagcttcaagggaagatgttggaacttatgagttgtgtgtttcaaacagcgctgga
tctctaacggttcctattactgtaattgtcctcgataaaccaggacctccagggcctata
catattgatgaagttagttgtgacaatgtaaccatttcttggactgctccagaatatgat
ggtggctgccaaattagcaattacattgttgaaaagagagagaccacttctaccacatgg
caagtagtttcacaagcagtggcaagaacatcgattaaaatagttcgtttgacaacagga
agtgagtaccagttccgtgtgtgtgcagaaaaccggtatggaaagagctcctacagtgaa
tcttcacctgttgttgcagagtatccattcacccctccaggtcctcccggtactcctaaa
gttgtgcatgccacaaaatctaccatgcttgtgagctggcaagtgccagttaatgacgga
ggaagtcacgttattggctatcaccttgagtataaagaaagaagcagcattctttggtca
aaagcaaataaaatccccattgcagatactcaaatgaaagtctctggtcttgatgaagga
ctaatgtatgagtatcgcgtatatgctgagaatattgctggaattggtaaatgcagtaaa
gcatgtgaaccagttcctgcaagagatccttgtgatcctcctggacaacctgaagtcaca
aatatcacaagaaagtcagtctcactcaaatggtctaaaccacattatgatggtggagct
aagatcacgggctacattattgaacgtagggaactaccagatggcaggtggctgaagtgc
aactatactaatgtacaagaaacatactttgaagtgactgaacttactgaagatcagcgt
tatgaattccgggtttttgcaagaaatgctgctgactcagttagtgaaccatctgaatcc
actggaccaattacagtcagagatgatgttgaggctccaagaattatgatggatgtcaag
ttccgggatgttatcattgtcaaagctggagaagtccttaagataaatgcagacattgca
gggcgacctctgccagtaatttcctgggccaaggatggtgtagaaattgaagaacgagca
agaacagaaattatctcaacagattatactaccttattaacagttaaagactgtataaga
cgagacactgggcagtatgtactaacactaaagaatgttgcaggaactcgctctatggca
gttaattgcaaggtacttgacaggcctggcccaccagcaggaccacttgaaatcaatggc
ctcactgctgagaaatgctctctttcctggggacgtccccaggaagatggtggtgcagat
attgactattacattgtagaaaagcgtgaaacaagccgccttgcctggacaatatgtgaa
gcagagtcgaggataacatcctgtaaagtgaccaagttactcaaaggcaatgagtacatc
tttagagtaactgctgttaataaatatggtgttggtgagcccctggagagtgtagctgta
aaggccctagacccctttacagttccaagcccacccacatctgtggaagttacatctgtg
accaaagattccatgacactttgctggtcaagaccagagagtgatggaggcagcgatatc
tctggatacataattgaaaggcgagaaaaaaatgccctacgatgggtacgtgtaaacaaa
aaaccggtttatgatctgagagtgaaatcaacaggacttcgggaaggatgtgaatatgaa
tatcaggtttatgcagaaaatgccgctggtctaagtcttccaagtgaaaccactccctta
gttcaggcagaagatcctgtgttcttaccatctcctccatccaaacccagaattgtagac
tctggcaagaccactatcactattggctgggttaagcccttgtttgatggtggggcccca
ataaccggatacactgtcgaatacaaaaagtctgatgaaactgattggaaaactgccatt
cagagtttcagaggcacagaatacacaatgagtggactaacaacaggagctgaatacgtt
ttcagcataagatctgtcaataaggttggtgctagtgatcccagtgacagttccgaccct
cagatagcaaaagaaagagaagaagaacctgtttttgatattgacagtgaaatgaggaag
actttgattgtcaaggctggtgcctcatttaccatgactgtgcctttccgaggaagacca
gtacctagcgtctcatggagtaagccagacactgacctccgcaccagagcatatattgat
tccacagattcccgtacatcacttactattgaaaatgccaacagaaacgattctggaaaa
tacacattaacaattcagaatgtgttgagtgctgcttcactaaccttcgctgtcaaagtt
ttagattctccaggtcctcctgccagtattacggtgcacgaagtaaccaaagagagtgca
gtgttatcctgggatgttcctgaaaacgatggaggagcaccagtgaagaagtaccacata
gagaaacgtgaggccagcaagaaagcctgggtctctgtcaccaacaactgtaaccgcctt
tcctacaaggttaccaccttacaagaaggagctacttactatttcagagtctctggagaa
aatgagtttggcattggtgtaccagctgaaacaaaagaaggcgtcaaaataacagaaaaa
ccaagcccacctgaaaaactcggagtaataaatgtcaccaaagacagtgtttgcttgacc
tggttgaagcccgaacacgatggtggaagcagaattgtacactatgttgtcgaagcacta
gaaaaaggacagaaaaactggcttaaatgtgctatggtaaagtcaacccagcatgttgtt
tctggtctgagggagaatcatgaatactttttccgagtctttgctgaaaaccaagctggc
ctgagtgacccaagagaactcctgcttcctgttcttgtaaaggagcagctagaaccacct
gaaattgatatgaaaaatttcccaagtcacactgtatatgttagagctggttcaaacctt
aaagttgacatcccaatttctggaaaaccattacccaaagtgaccttatcaagggatggt
gttcccctcaaggcaaccatgagatttaatactgaagttactgctgagaacctgacgatc
aatcttaaagagagtgttacagctgatgctggaagatatgagatcactgctgccaactct
agtggaacaaccaaagctttcattagcatcatcgtgctggacaggcctggtcctccaact
ggccctgttgttattagtgacataactgaagaaagtgtggttctcaagtgggagccacct
aagtatgatggtggaagccaagtaaccaattacattgtacttaagagagaaacaaatact
gcagtatgggctgaagtgtctgcaatggttgccagaacagtgattaaagtcatgaaactg
accacaggtgaagaataccaattccgcatcaaggcagaaaaccgctttggtatcagcgat
cacatagattcagcttgtgtggttgtcaaactaccatacacaacacctggacctccttca
acaccatgggtcactaatgttactcgtgaaagcatcaccgtgagctggcatgaaccagtg
tccaatggaggcagtgcagtcacaggctatcacttggaaatgaaagacagaaacagtatt
ttatggcaaaaagccaacaaaatgcttatccgtacaactcacttcaaagttacaacaatc
agtgctggacttatttatgaattcagggtgtatgctgaaaatgctgctggtgttggaaaa
cccagccatgcttctgaaccagtcttggccattgatgcctgtgaacccccaagaaatctt
cgtattactgacatttcaaagaactctgtcaacctttcttggcaacaaccagcgtttgat
ggaggaagcaagattacaggctacattgttgagagacgtgaccttccagatggcagatgg
accaaggccagcttcactaatgttattgagactcaattcactgtctctggcttgactcag
aattcccagtatgaattccgtgtctttgctaggaatgccgttggctccatcagcaatcca
tctgaggttgtaggccctattacgtgcatcgattcttatggtggacctgtaattgacttg
cctctagaatatacagaagttgtcaaatacagagcaggtacatctgttaagctcagagct
ggcatttctggaaaacctgagcccacaattgagtggtataaagatgacaaagaattacaa
accaatgcactggtatgtgttgaaaataccactgatcttgcatctatactcatcaaagat
gccaaccgccttaacagtggaagctatgaattaaaactaaggaatgccatgggctcagcc
tcagccaccatcagagtacagatccttgataaaccaggacctccaggtggcccaattgaa
tttaagactgtaactgctgaaaagataacccttctctggcggcctccagctgatgatggt
ggtgcaaaaatcactcactacattgtagaaaagcgtgagacaagccgcgttgtgtggtct
atggtggctgaaaatttggaagagtgcatcattacaacaaccaaaattatcaaaggaaat
gaatatgtcttccgggttcgagctgtgaacaaatatggaattggcgagtcactggaatca
gagccagttgtagccaagaatgcatttgttacacctgggccaccaagtgtaccagaggtg
acaaagattaccaagaattcaatgaccgttgtctggagcaggccagttgcagatggtggt
agtgaaataagtggctatttccttgaaaaacgagacaagaagagtctaggatggtttaaa
gtactaaaggaaaccatccgtgacactagacagaaggtgacaggactcacagaacagagt
gactatcaataccgcgtttgtgcaataaatgctgctggaatgggtccattttctgaacca
tctgacttctacaaagctgctgatcctattgatcctccaggcccacctgccaagataaga
attgcagattcaactaagtcatccatcactcttggctggagtaaaccagtctatgatgga
ggcagtgctattactggatacattgtcgagatgagacagggagaggaagaggaatggaat
attgcctctaccaaaggagaggtcagaactacagaatatgtagtatcgagcctacaacct
ggagtcaattactacttccaggtatctgcagtaaactgtgctggacaaggagaacctata
aaaatgaccgaacctgtacaagctaaagatatacttgaggaaccagagattgacctagat
gtagctctccgatcatctattatagctaaagctggtgaagatgtacaagtcttgattcct
ttcaaaggcagaccctcacctactgtcacttggagaaaagatgagaagaatcttggcagt
gatgccagatacagcattcaaaacactgattcatcttctttactcattattcctcaagtt
actcggaacgatacaggcaaatatattttgacaatagaaaatggagttggccaaccaaag
tcttcaactgtgaatgttaaagtgcttgatactccagcagcctgccagaaactacaggtt
aaacatgtttctcgaggcactgtcactctcttctgggatcctcctctcatcgatggagga
tctcccataattaattatgtcattgaaaagagagatgccacgaagagaacatggtcttcc
gtgtcacacaaatgttctagtacatcctttaagatcacagatttgtcagagaaaacacca
ttcttcttcagagttcttgcagaaaatgaaatgggagttggcgaaccctgtgaaactacc
gagccagtgaaagctgctgaagtaccagctcccatacgtgatctctcaatgaaagattcc
acaaagacatctattatcctgagctggaccaaacctgactttgatggtgggagtgtcatc
acagaatatgttgtggaaaggaaaggtaaaggcgagcaaacatggtcacatgctggcata
agtaaatcatgtgaaattgagattagccaactaaaagaactgtcagtcctggaattcaga
gtgttcgccaaaaatgagaaaggactaagtgatgctgtcactattggaccacttacagtg
aaagaacttgtaattacacctgaagtcgacctgtcagaaatccctggcgcacaaatctca
gtgagaattgggcataatgtacaccttgaattaccttataaaggaaaacccaagccatct
atcagttggctgaaagatagtttgccattgaaagaaagtgaaaatgttcgcttcagtaaa
actgaaaagaaaatcaccttgaatattaagaacgtcaagaaagaacatggaggaaagtac
actgttattctggataatgcagtgtgtagaaactcattccccattacaatcatcaccctc
ggcccaccatcaaagcccaaaggacccattcgatttgatgaaatcaaggctgagagtgcc
atcatgtcctgggatataccagatgatgatggaggaggagaaattacttgttacagcatt
gagaagcgggaagcttcccaaactaattggaagatggtatgttcaagtgttgccaggacg
actttcaaagtttctaatctagtcaaagatgccgaataccagtttagagtcagggcagaa
aacagatacggagtcagtgaaccacttgtctcaaatctcattgtggcaaaacacgagttc
aggattcctggccccccaggaaagccagttgtatacaatgtgacctctgatggcatgtca
ctaacttgggatgcaccagtttatgatggtggctcagaagttactggattccatgttgaa
aagaaagaaagaaatagcatactctggcaaagagttaacacgtcaccaatatctggaaga
gaatatagagcgactggattaatagaaggactggattaccaattccgagtatatgctgaa
aattctgctggcctaagctcacccagtgacccaagcaaatttaccttagctgtctcccca
gtggatccacctggcactcctgactacattgatgtcaccagggaaaccatcacacttaag
tggaacccaccattgcgcgacggaggcagtaagattgtggcctacagcattgagagacgg
caaggggatgatcgctgggtcagatgcaactttactgacatcagtgaatgccagtacaca
gttacaggacttagtcctggggatcgatatgaattcagaataattgcaagaaatgctgtt
ggaactataagcccaccctcacagtcttctggtgttattatgacaagagatgaaaatgtt
ccaccaacagtagagtttggccctgagtattttgacggtatcattattaagtctggagag
agccttagaattaaagctttggtacaaggacgaccagtacctcgagtaacttggttcaaa
gatggagttgaaatcgaaaagagagtgaatatggaaataactgatgtccttggatctacc
agcctctttgttagagatgctactcgagaccatagtggcctatatacagtggaagccaaa
aatgtatctggcaccacaaaagcagatattaaagtgaaagtacaagatacaccaggaaaa
gtagttggcccaataagattcaccagtattactggtgagaagatgactctgtggtgggat
gcaccactcaatgacggctgtgctcctgtcacccactacatcattgaaaaacgggaaacg
agcagacttgcttgggcattaattgaagataaatgtgaggcccagagttatactgccatt
aaactaataactggcaatgaataccagttccgtgtttctgccgttaacaagtttggtgtt
ggcaggccacttgattctgacccagtgattgctcaaatacaatacaccgttcctgatgcc
cctggcattccagagcctagcaatgtaacaggcaatagcattaccctgacatgggcaagg
ccagaatcagatggtggcaatgagattcaacactacatccttgaaaggagagaaaagaaa
agcacgagatgggtaaaagtgatcagcaaacgaccaatctctgaaacaagattcaaaatc
actggtctgatagaaggcaatgagtatgaattccatgtcatggctgaaaatgcagcagga
gtaggacctgcaagtggcatctcaagactaattaaatgcagagagcccgttaacccacca
agtgctcccacagtggtaaaagtgacagacacatcaaagacaactgtgagcttggaatgg
tccaggccagtctttgatggcggcatggaaataattgggtacatcatagaaatgtgcaaa
gctgatctaggagactggcacaaggtaaatacagaggcatgtgtgaaaacaagatacaca
gtcactgatttacaagcaggagaagaatacaaattccgggtgagtgctatcaacggtgtt
ggaaaaggagacagctgtgaagtgactggtacaattaaagccgttgaccgactaacagct
cctgaattagacattgatgcaagcttcaaacagactcacattgttagagctggtgccagt
attcgcctctttattgctttccggggtagacctacccctacagctgtgtggagcaagcca
gactctaatcttagtattcgggctgatatccatataacagactccttcagcaccctgact
gtggaaaactgcaacagaaatgatgcagggaaatatacccttactgtggaaaataacagt
ggtagtaagtcaatcacgttcactgtgaaggtgctagactctccaggaccacctggtccc
attaccttcaaagatgtaacccggggatctgctacattgatgtgggatgcacctctactg
gatggtggtgcccgaatccatcactatgtggtagagaaacgagaagcaagtcgccgtagc
tggcaagttgtcagtgaaaaatgtactcgtcagatcttcaaggttagtgacctagcagaa
ggcgttccatactacttccgtgtttctgcagaaaatgagtatggtgttggtgaaccatat
gaaatgccagaaccaattgtagccacagaacagcctgctccacctagaagacttgatgtt
gttgacactagcaaatcctctgcagtcttagcatggcttaaacctgaacatgatggaggc
agccggattactgggtacctacttgaaatgagacaaaagggatctgacttctgggttgaa
gctggtcacaccaaacagctgacattcacagtagaacgccttgttgagaacacagaatat
gaattccgtgtgaaagctaagaatgatgctggctacagtgaacccagagaagccttctca
tctgtcatcatcaaagagcctcaaattgagccaactgctgatctcactggaattaccgac
cagctcataacttgcaaagcgggaagcccattcactattgatgtgccaatcagtggtcgt
ccagcccccagagtaacatggaaactggaagaaatgagacttaaggagactgatcgagtg
agtatcataacaacaaaagacaggaccaccctctctgtaaaggacagcatgagaggtgac
tctggcagatacttcttaaccctggaaaacacatctggcgttaaaacatttaccatcaca
gttgtggtcattggaaggccaggtccagtaactggccccattgaggtctcatctgtctca
gctgaatcatgtgtcctgtcatgggctgaacctaaagatgatggaggcaccgaaattact
aattacatagttgaaaagcgtgagtcgggcacgacagcttggcagctcatcaattccagt
gtcaagcgcactcagattaaagtcactcatctcacaaaatacaaggagtattctttccgt
gttagttcagaaaacagatttggtgtgagcaagcctttagaatcagcaccgattgttgct
gagcatccatttgtcccaccaagtgctcctaccagaccggaagtctaccatgtgtctgcc
aatgccatgtctattcgttgggaagaaccctaccatgatggtggcagtaaaatcactggc
tactgggttgagaagaaagaacgtaacaccattctttgggtgaaggaaaacaaagtgcca
tgtttagagtgcaactacaaagtgtctggtttggttgaaggactggaatatcagtttaga
acttatgctctcaatgctgcaggtgttagcaaggccagtgaagcttcaagacctgtaatg
gctcaaaatccagttgacgcaccaggcagaccggaagtgacagatgtcacaagatcgaca
gtgtcactgatttggtctgccccggtgtatgacggaggcagcaaagtagtgggctatatc
gtggagcgtaagccagtcagtgaggttggagacggtcgctggctaaagtgcaactatacc
atcgtatcagacaactttttcactgtaactgctctcagtgagggagacacttatgaattc
cgtgtattggccaagaatgcagcaggtgtaatcagcaaaggatcagaatccacaggcccc
gtcacatgccacgatgaatacgctccgcccaaagccgaattggatgccagattacagggt
gacctggttaccattagagcaggttcggatctggttcttgatgctgcagttggtggcaaa
cctgaacccaaaattatctggaccaaaggagacaaggaactcgatctctgtgaaaaagtc
tctttgcagtatactggcaaacgagcaactgctgtgatcaagttctgtgacagaagtgac
agcggaaaatatacattaacagtcaagaatgccagtgggatcaaggctgtgtctgtcatg
gtcaaagtgcttgactcccctggcccatgtggaaaactcaccgtgagcagagtaacagag
gagaagtgtactttagcctggagccttccccaagaagatggaggagcagctatatctcat
tacattgtagaaagacgagagactagcaggctcaactgggtgattgttgaaggcgaatgc
ccaaccctatcctatgtggttaccagactcatcaagaacaatgaatacacattcagagta
agggcagtaaacaaatatggccctggtgtgcctgttgaatcagagccaattgtagccaga
aactcattcactattccatcccaacctggcatacctgaagaagttggggccggcaaagag
catatcattattcagtggacaaaaccagaatctgatggtggcaatgagatcagcaactac
ctggtagacaagcgtgagaagaagagcctgcgctggacacgtgtcaacagagattacatg
gtgtatgataccaggctgaaggtgaccagcctgatggaagggtgtgattaccagttccga
gtgactgcagtgaatgctgctggtaacagtgaacccagcgaagcttccaacttcatttca
tgcagagaaccatcatatacccccggaccaccttccaccccaagagttgtggacaccacc
aagcgcagcattagtttggcttggaccaagcccacgtatgatggtggtgctgacatcata
ggatatgtacttgaaatgaaagagaaagacactgaccagtggtacagagtacataccaat
gccacaataagaaatactgaattcactgtgccagaccttaaaatgggccagaaatactcc
ttccgagttgcttctgtgaatgagaagggtatgagtgaatacagtgaaacaactgctgaa
attgaacctgtggaaagactagaaataccagatcttgagcttgcagatgatctgaagaag
actgtaaccatcagggctggggcctcactgcgcctgatggtgtccgtatctggtagacca
cctcccgtcatcacatggagcaagaaaggcattaaccttgcaaaccgggcaattattgac
aacactgagagctactctttacttattgtggacaaggttaatcggtatgatgctggaaaa
tacacaattgaagctgaaaatcaatctggcaagaaatcagcaacagtccttgttaaagta
tatgatactcctggtccctgtccttcggtgaaagttaaggaagtatcaagagattctgtg
accattacttgggaaatccccacaattgatggtggcgctccagtcaacaattacattatt
gagaagcgtgaagctgccatgagagcattcaaaacagtaaccaccaaatgcagcaagaca
ctttaccgaatttctggacttgtagaaggaatgatgtactatttcagagtgcttccagaa
aacatttatggcattggagaaccctgtgaaacatctgatgcagttttggtctcagaagtg
ccgttggtgcctacaaagctggaagtggttgatgtcaccaaatccactgtcactcttgcc
tgggaaaagccactctacgatggcggtagccgactcactggatatgttctggaggcctgc
aaagctggcacagaaagatggatgaaggttgtcaccttaaaacccacagtcctagagcac
actgttatttccttaaatgaaggtgaacaatacttatttagagtaagggcacaaaatgag
aaaggtgtatcggaaccaagagagatcgtcacagcagtgactgtacatgacctcagagtg
ttgccaacaattgatctttctacaatgcctcaaaagaccatccatgtcccagctggcaga
ccagtggagctggtaatacccatcactggtcgtccacctcctactgcttcctggttcttt
tctggttctaaactgaaagaatcagaacgtgtcacagttgaaactcatactaaagtaact
aaattaaccatccgtgaaaccactataagagatactggagaatatacacttgaattaaaa
aatgttactggaactacttcagacactattaaagttatcattcttgacaagcctggtcca
ccaactgggcctatcaagattgatgaaattgatgctacgtcagttactatttcctgggaa
ccacctgaattggatggtggtgctccactgagtggttatgtggtggaacaacgtgatgct
catcgtccaggatggctgccagtttctgaatcagtgactagaccaacgtttaagtttact
agactcacagaaggaaatgaatatgtgttccgtgtggctgcaacaaaccgctttgggatt
ggctcatacttgcagtctgaagtcatagaatgccgcagcagcatcagtattcctggaccc
ccagaaacattacagatatttgatgtctcccgtgatggcatgacacttacttggtatcca
cctgatgatgatggtggctcccaagtgacaggatatattgtggagcgcaaagaagtgaga
gcagatcgatgggtccgtgtaaataaagtaccagtcacgatgacacggtaccgctccact
ggccttattgaaggcttagaatatgaacaccgtgtcacagccattaatgcaagagggact
ggaaaaccaagtcgtccttccaaacccatagttgccatggatccaattgctccaccagga
aagccacaaaatccaagagttactgatacaacaaggacatcagtctccttggcctggagt
gttccagaggatgaaggaggatctaaagttacaggctacttgattgaaatgcaaaaagta
gatcaacacgaatggaccaaatgcaacactacaccaaccaagattcgagagtatactctg
acacacctacctcagggcgctgaatacagattccgcgtcctagcttgtaatgctggtgga
cccggggagcctgctgaggtaccaggaacagtcaaagtcacggaaatgcttgaatatcct
gactatgaacttgatgaaagataccaagaaggtgtctttgtaagacaaggtggagtcatc
aaacttaccatacctatcaaaggaaaaccattcccgatatgtaaatggaccaaggaaggc
caggatattagtaagcgtgccatgatcgcaacatctgaaacacacactgaacttgtgatc
aaagaagcagacaggaatgattctggaacttatgacttggttctggaaaataaatgtggc
aagaagactctttacatcaaggtcaaggtaataggaagtcccaacactcctgaagggcca
cttgaatatgacgatatacaagcccgatctgtgagggtcagttggagagctcctgctgat
gatggtggtgccgacatcttaggctacatccttgagagaagagaagtgcctaaggctgcc
tggtatactattgattccagagtccgaagcacatctctggttgtaaaaggcctcaaagaa
aatgtggaataccatttccgtgtctcagcagaaaaccagtttggcataagcaaacccttg
aagtctgaggaaccagtaataccaaaaacaccactgaatcctccagaacctccaagcaat
cctccagaagtacttgatgtgaccaagagttctgttagtttgtcctggtcccgtcccaaa
gatgatggtggctctcgagtcacaggttactacattgaacgcaaagagacatcaactgac
aaatgggtcagacacaataagactcagataaccaccacaatgtacaccgtcactggactt
gttcctgatgccgagtatcagttccgcatcattgcacagaatgatgttggcctcagtgag
accagccctgcttctgaaccagttgtttgcaaagatccatttgataaaccaagccaacca
ggagaacttgagattctttcaatatccaaagacagtgtcactctgcagtgggagaaacct
gaatgcgatggtggcaaagaaatcctcggatattgggttgaatataggcagtctggagac
agtgcttggaagaagagcaataaggatcgcatcaaggacaggcagttcacaattggggga
ttgcttgaagctactgaatatgaattcagggtttttgctgagaatgagactggacttagc
agacctcgaagaacagctatgtctgtaaagactaagttaacatctggagaggctccagga
atacgccaagaaatgaaagatgttactaccaaattgggtgaagctgctcagctctcatgc
cagattgttggaaggcctcttcctgacattaaatggtaccgatttggtaaggagctcgta
caaagccggaaatacaaaatgtcctcagatggacgcacgcataccctgacagtaatgacg
gaggaacaagaagatgaagggatctatacctgcatagctaccaatgaagttggagaagta
gaaacaagtagtaagcttctcctgcaggcagcaccacagttccatccgggttacccactg
aaagagaaatattatggtgctgtgggctctacacttcgactccatgttatgtacattggt
cgtccagtacctgccatgacctggttccatgggcagaaacttttgcaaaactcagaaaac
gttactattgaaaatactgagcactatactcatcttgtcatgaagaatgtccaacgtaag
actcatgctgggaaatacaaagttcagctcagcaatgcttttggaacagttgatgccatc
cttgatgtggaaatacaagataaaccagacaaacctacagggccaattgtgattgaagct
ctcttgaagaactctgtggtgatcagctggaaagcacctgcggatgatggaggctcctgg
atcaccaattatgtggtggagaaatgtgaggccaaggaaggggctgaatggcagttggtg
tcttcggccatctcagtgacaacctgtagaattgtgaacctgacagaaaatgctggctac
tacttccgggtttcagctcagaacacctttggcatcagtgagcctctagaggtcgcctca
gttgtgatcattaagagtccatttgaaaagccaggtgttccaggcaagccaattattact
gctatcacaaaagattcttgtgttgtggcttggaagccacctgccagtgatggaggtgca
aagattagaaattactacctcgagaagcgtgagaagaagcagaataaatggattgctgtg
acaacagaagagattcgagaaactgtcttctccatgcaaaaccttattgaaggtcttgaa
tatgagttccgtgtgaaatgtgaaaacctaggtggggagagtgaatggagtgaaacatca
gaacctgtcactcccaaatctgatgtcccaattcaagcaccacactttaaagaggaactg
agaaatctaaatgtaagatatcagagcaatgctactttggtctgcaaagtgactggtcat
ccaaaacctgttgtgaaatggtatagacaaggcaaagaaatcattgctgatggattaaag
tacaggattcaagaattcaagggtggctaccaccagctcattattgcaagtgtcacagat
gatgatgccacagtataccaagtcagagctaccaaccaagggggatctgtgtctggcact
gcctccttggatgtggaagttcccgctaagatacacttgcctaaaaatcttgaaggcatg
ggagcagttcacgctctccgaggcgaggtggtcagcatcaagatccctttcagtggcaaa
ccagatcctgtgatcacttggcaaaaaggacaagatctcattgacaataatggtcactac
caagttattgtcacaaggtcctttacgtcacttgttttctccaatggagtggagagaaag
gatgctggtttctatgtggtctgtgctaaaaacagatttggaattgatcagaagacagtt
gaactggatgtagctgacgttcctgacccacccagaggcgtcaaagttagtgatgtttca
cgagattctgtcaacctaacgtggacagagccagcttctgatggaggcagcaaaatcacc
aactatattgttgaaaaatgtgcaactactgcagaaagatggatacgtgtaggacaggcc
cgagaaacacgttataccgtcatcaacttatttggaaaaacaagttaccagttccgagta
atagctgaaaataagtttggcctgagcaaaccttctgagccttccgaaccaaccataacc
aaagaagataagaccagagctctgaattatgacgaagaggttgatgaaaccagggaagtt
tccatgactaaagcatctcattctaaaaccaaagaactctacgacaaatacatgattgct
gaagatctcgggcgcggtgaatttggaattgttcaccgttgtgttgaaacatcctcaaag
aagacattcatggccaaatttgtaaaagtcaaagggactgaccaagtgttagtaaagaag
gagatttccattctaaacattgctaggcacagaaacatcttatacctccatgaatcattt
gaaagcatggaagaattagttatgatctttgagttcatatcaggacttgacatatttgaa
cgcattaacacaagtgcttttgaacttaatgaaagagaaattgtaagttatgttcgccaa
gtctgtgaagcacttgagttcttacatagccatagtattggacactttgacattagacca
gaaaacatcatttaccaaacaagaaggagctccatcattaaaataatagaatttggccaa
gcccggcaactgaaaccaggggacaacttcaggcttctcttcactgctcctgagtactat
gcccctgaagtccaccagcatgatgttgtcagcacagccactgatatgtggtcacttggt
acactggtatatgtattgctgagtggtatcaacccattcctggctgaaactaaccaacag
ataattgagaatatcatgaatgctgagtatacttttgatgaagaagcgttcaaagaaatt
agctttgaagccatggattttgttgaccggctcttagtgaaagaaagaaaatctcgcatg
acagcatctgaggcactccagcacccatggctaaagcagaagatagaaaatgtcagtact
aaagtcatcagaacattaaaacaccggcgttattaccataccctgatcaagaaagacctc
aacatggttgtgtcagcagcccgcatttcctgtggtggtgctattcggtctcagaggggt
gtgaatgttgccaaggttaaagttgcgcccattgaaattggcccgatttctgggcagata
atgcatgccattggtgaagagggaggatatgtcaaatatgtatgcaaaattgaaaattat
gatcaggctacccaagtgacctggtactttggtgtcagacagttagagaacagtgaaaag
tacgaaatcacttatgaagatggtgtggccactatgtacatcaaagacatcaccagattt
gatgatggtacctacagatgcaaagtagtcaatgactatggtgaagacagttcctatgtg
gagctgctcgttaaaggtgtgagagaagtttatgactattactgccgtagaagtgtgaag
aaaatcaagcgcagaacagacacaatgagactcttggaaaggccaccagaatttaccctg
cctctctataacaagacagcttatgttggtgaaaatgtccggtttggagtaactataact
gtccacccagagcctcgtgtaacatggtataaatcaggtcagaaaatcaaaccagatgaa
gatgacaagaagtatacatttgagtctgacaaaggtctttaccaattaacaatcaacagc
gtaactgcagatgatgatgctgaatatactgttgtggcaaggaacaaatatggtgaagac
agctgtaaagcaaagctgactgtaaccctacacccacctccaacagaaactaccctcaga
cccatgttcaaacggctactggcaaacgcagaatgccaagaaggccaaagcatctgcttt
gagatcagagtctctggcattcccccaccaacactaaaatgggagaaagatggtcagcca
ctgtccctcgggcctcatattgaaattgtccatgaaggcttggattattatgctttgcac
atcagggatacttttcctgaggacacaggttattatagagtcacagccacaaatacagct
ggatccaccagctgccaggctcacttacaagtggaacgcttgagatatgtcaagcaggaa
tttgagagtaaggaggagcgtgagcgacatgtgcaaaaacagatcgaaaagacactaaga
atggctgaaattctttctggaactgaatccgtgtcactgacaaaggtagcccaagaggct
ctgagagaagctgccatcctatacaaaccagctgtcagcactaagactgtgaaaggagag
taccgacttgagacagaagaaaagaaggaggagaggaaattccgtatgccttatgaagta
ccagagccacgcaagtaccaacaagccactgtagaagaagaccagcgcatcaagcagttc
gtgcctatgtctgacatgaaatggtacaagaagatccgcgatcagtttgaaatgcctggg
aaacttgacagaattgtacagaaaagacccaagcgcatccgcctttcaagatgggaacag
ttctacgtgatgcctcttcctcgtatcacggatcaatacagacccaagtggcggataccc
aagctctcccaagacgatctggaaatggtgcgaccagcccgccggcggacaccttctcct
gattattacttttattacagacctcggagacgttctctgggtgacatgtcagatgaggaa
ttgcttctccccatcgatgactacctagccatgaagaggacagaagaggaaaggctgtgt
cttgaagaagagcttgagttaggcttctcagcttcacctcccagccgaagccctccacgt
tttgagctttctagcctacgttactcttcaccacaagctcacatcaaggtggaggagaaa
agaaaagacttcaggtattcaacctatcatgtccctgtgaaggaagaaacgcgtacgagt
tatgcagaactgcgagaaaggcacgctcaggcctcctaccgacagcccaagcagcgacag
aggatcatggcagagaaggaggatgaggagctgctccggccagtgaccaccacccagcgt
ctctcggaatacaggaatgagcttgaccacatgtcaaaggaagaaaagtctaaaaagaaa
tcgaaacgacagagaaaagtgatggaaataacagaaattgaggaagaatatgaaatctca
aggcgtgctaaaagagaatcatcctcatccgtgtccagactgctgagacgccggcgctcc
ctgtccccaacttacattgaactaatgaggccagtgtctgaattgatccggtcacgtcca
cagccagctgaggaatatgaagatgacctcgaaagaaggtcccccactccagagagaact
cgcccacgttcccccagccctgtgtctagtgagagatcactctcaagatttgagaggtct
gcacgatttgatatcttttccaggtatgagtccatgaaagctgctttgaagactcagaag
acatcagaaaggaagtatgaagttttgagccagcagcctttcacgctggaccatgcccct
cgaatcacattgagaatgcgctcccacagggtgccgagtggccagaatacacgcttcatt
ttaaacgttcagtctaaaccaactgctgaggttaaatggtaccataatggcgtggaactc
caagagagcagtaagattcattacaccaacacgagtggggtcctgaccctggaaattctg
gattgtcatcgtgaagacagcggaacctaccgtgctatatgcaccaattacaaaggcgaa
gcttctgactatgcgaccctggatgtaactggaggcgattatatcacctatgcatcccag
cgcagagacgaagaggtccccagatctgttttccctgagctgacgaaaacagaggcatat
gcagtttcatcatttaagaaaacatctgagatggaagcttcttcttctgtcagggaaatg
aaatcagagatgacagagacaagggaaagtctctcctcatatgaacaccacgcctctgcg
gaaatgaaaagtactgcattagaagaaaagtcagtggaagaaaaatccaccaccaggaag
atcaagacgacattggcagcaagaatcctcacgaaaccacgatccataactgtctacgaa
ggtgagtctgcaaggttttcttgtgatacagatggtgagccagtaccaactgtgacctgg
ctacggggaggacaagtgataagtacttccacccaccaccaggtgactaccacaaagtac
aaatcgacctttgagatctcttcagcacaggcttccgatgaaggcaactacagcgtggtg
gtaaaaaacagtgaagggacacaggaagcacaattcaccttgactgtccaaaaggccagg
gtcactgaaaaggctgtgacatcaccaccaagagtcaagtccccagagcctcgagtaaaa
tccccagaagctgctaagtctccaaaacgagtgaaatctccagaaccagtgacttcttca
aaagctgtatcacccacagagacaaagcccacaccaatagagaaagctcagcagctacca
gcctctggcccaccaaagataagtcagtccctgaaagcagaagcttctaaagatgttgca
aagctgacttgtgcagttgaaagcagtgtactatgtgcaaaagaggtcacctggtataaa
gatggcaaaaaactcaaggaaaatgggcatttccaattccattactcagcagatggtacc
tatgagctcaaaattcataatctcacagagtctgattgtggagaatatgtttgtgaggtc
tctggtgaaggtggaacttccaaaactagcttccagtttaaaggacaggcttttaagagt
gtccatgagcaggtatcaagcatatcagaaactaagaaatcggctcagaaaactgctgaa
tcaacagaaaccaagaaatcagctcaaaaatctggtgagccaatagaaaccaagaaaact
gaaccaaaagccccagaaccaatctcctcaaaaccagtaattgttactgggctgcaggat
actaccatttcttcagacagtattgctaaatttacagttaaagctactggagaaccccag
ccaactgtcacctgggcaaaggatggaaaggcgattacacaaggaggtaaatacaaactc
tctgaagataaaggaggattcctcttagaaattcagaagactgacacttctgacggtgga
ctttacacctgtacagtaacaaattcagctggatcagtgtcctctagctgcaaactgaca
ataaaagctgcaaaagacagcaagacacagaaagtatctacacaaaagacctctgaaatt
gcagctcagaaggcagctgtccaagaggaaatctcccaaaaggccctaatttctgaagag
gtcaaaatatcagaggtgaaatctcaagacaagttagccctcaaagaggaagtcaagaaa
tcagcagcaacctccctggaaaaatccatcatccaagaagaagtcactaaatcatcacag
gcattagaagaggtcagaactcaagctgagattaaagcattttcttctcagatgagcata
accgatggccaaaaagtgactttaaaagccaacattgctggcgccactgacgtgaaatgg
gtactaaatggactagagcttgctaactccgaggagtacagatacggggtctcgggcagt
gatcagaccctcaccatcaagcaggccagtcacagagatcaaggagtcctcacctgcata
ggcaaaacaagccaaggagttgtcaagtgtcagtatgacctgaccctgagcaaagaactc
tcagatgctccagccttcatctcacagcccagatctcaaaatattaacgaaggacaaaat
gttctcttttcttgtgaaatcagtggggagccatcccctgaaattgaatggtttaaaaac
aacctgccaatttctgtttcttcaaatatcagtgtaagccgctccagaaacatatataca
cttgaaatccgaaacgcatcagtaagtgatagtggaaaatacacagttaaggccaaaaac
ttccgtggccagtgttcagctacagcttccttaacagtccttcctctagtcgaagaacct
tccaaagaggtagtattgaggacacgtggcgacacgagcttgcaaggaagcttctcgtct
cagtcagtccaaatgtctgcctctaagcaggaggcctccttcagcagtttcagcagcagc
agtgctagcagcatgactgaaatgaaatttgcaagcatgtctgcccaaagcatgtcctcc
atgcaagagtcctttgtagaaatgagttccagcagttttatgggaaaatctagtatgaca
caactggaaagctcaactagtagaatgattaaagcaggcataagaggaattccacctaaa
attgaagctcttccctctgatatcagcatcgatgaaggtaaagttctcacagtagcctgc
gcttttacgggggagcctaccccagaaataacatggtcctgtggtggaagaaaaattgaa
aaccaagaccaacaagggagattccacattgaaaacacggacgacttaacgaccctgatc
atcatggacgtacagaaacaagatggaggactttataccctgagcttagggaatgaattt
ggatctgactctgccactgtgaatataaatattcgctccatgtaa

DBGET integrated database retrieval system