KEGG   Heterocephalus glaber (naked mole rat): 101718787
Entry
101718787         CDS       T02812                                 

Gene name
Egln3
Definition
(RefSeq) egl-9 family hypoxia inducible factor 3
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04066  HIF-1 signaling pathway
hgl05200  Pathways in cancer
hgl05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101718787 (Egln3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101718787 (Egln3)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101718787 (Egln3)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     101718787 (Egln3)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4 ProRS-C_1
Other DBs
NCBI-GeneID: 101718787
NCBI-ProteinID: XP_004867634
UniProt: G5BG39
Position
Un
AA seq 239 aa
MPLGHIMRLDLEKIALEYIVPCLHEIGFCYLDNFLGEVVGDCVLERVKQLHYNGALRDGQ
LAGPRAGVSKRHLRGDQITWIGGSEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKA
MVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGVLRIFPEGKSFIADVEP
IFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALAED
NT seq 720 nt   +upstreamnt  +downstreamnt
atgcctctgggacacatcatgaggctggatctggagaaaatcgccctggagtacatcgtg
ccatgtctgcacgagatcggcttctgctacctggacaacttcctgggcgaggtggtgggc
gactgtgtcctggagcgcgtgaagcagctgcactacaacggggccctgcgcgacggccag
ctagccgggccgcgcgccggcgtctccaagcggcacctgcggggcgaccagatcacgtgg
atcgggggcagcgaggagggctgcgaggccatcagcttcctcttgtccctcatcgaccgg
ctggtcctgtactgtgggagccggctgggcaaatactacgtcaaggagaggtccaaggca
atggtggcttgctatccaggaaatggaacaggttatgttcgccatgtggataaccctaat
ggtgacggccgctgcatcacctgcatctactatctgaataagaactgggatgccaagctg
catggcggggtcctgcgaatatttccagaagggaaatcattcattgcagatgtggagccc
atttttgacagactcttgttcttctggtcagaccgcaggaacccacatgaagtccagcct
tcctatgcaaccagatatgccatgactgtttggtactttgatgctgaagaaagggcagaa
gccaagaagaaattcaggaatttaactaggaaaactgaatctgccctcgctgaagactga

DBGET integrated database retrieval system