KEGG   Heterocephalus glaber (naked mole rat): 101718900Help
Entry
101718900         CDS       T02812                                 

Gene name
Oxct1
Definition
(RefSeq) 3-oxoacid CoA-transferase 1
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00072  Synthesis and degradation of ketone bodies
hgl00280  Valine, leucine and isoleucine degradation
hgl00650  Butanoate metabolism
hgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101718900 (Oxct1)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    101718900 (Oxct1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101718900 (Oxct1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     101718900 (Oxct1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-GeneID: 101718900
NCBI-ProteinID: XP_004848631
UniProt: A0A0P6IX94
Position
Un
AA seq 520 aa AA seqDB search
MAACKLFSSGLRLSASSRSSGAAWSKGCVCYFSTSARHHTKFYNDPVEAVKDIPDGSTIL
VGGFGLCGIPENLIGALLKTGVKGLTVVSNNAGVDNFGLGLLLRSKQIKRMISSYVGENA
EFERQFLSGELEVELTPQGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGAPIKYNKDGSI
AIASKPREVREFNGQQFILEQAITGDFALVKAWKADQAGNVIFRKSARNFNLPMCKATET
TVVEVEEIVAIGSFAAEDIHIPKIYVHRLIKGEKYEKRIERLSIRKESDEKPESDKPGDN
IRERIIRRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPFAHEAD
ADLINAGKETVTVLPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMV
KGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDK
KKGLTLIELWEDLTVDDIQKSTGCDFAVSPKLIPMQQITT
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctgcaaactcttctcctcggggcttcggctcagcgcctcctcccgtagctct
ggggctgcctggtccaagggatgtgtttgctacttttcgacaagtgcccgtcaccatacc
aaattttataatgatccagtggaagctgtaaaagacatccctgatggttcaaccattctg
gttggtggttttgggctatgtggaattccagagaatcttattggagctctgctgaagact
ggagtaaaagggctaactgtagtcagcaacaacgcaggggtcgacaactttggcttgggc
cttttacttcgatccaagcagataaaacggatgatctcttcatatgtgggggaaaatgca
gagtttgaacgacagttcttatctggtgaattagaagtagaactgacacctcagggcaca
cttgcagagaggattcgagcaggtggggctggagttcctgcattttacaccagcacaggg
tatgggaccctggtgcaagaaggaggagcacccattaaatacaacaaggatggcagcatt
gccattgccagtaagccaagagaggtgagggagttcaatggccagcaatttattctggag
caagcaattacaggggattttgctttggtgaaagcctggaaagcagaccaagcaggaaat
gtgattttcaggaaaagtgcaaggaatttcaatttgccaatgtgcaaagctacagaaacc
acagtggtagaggttgaagaaattgtggctattggatcatttgctgcggaagatattcat
attcctaagatttatgtacatcgccttataaagggagaaaaatatgagaaaagaattgag
cgtttatcaatccggaaggaaagtgatgaaaaacccgaatctgataagcctggagataat
ataagggaacgaatcatcagacgggcggctcttgaatttgaggacggcatgtatgctaat
ttgggcataggaatccctctcctggctagcaactttataagcccaaatataactgttcat
cttcaaagtgaaaatggagtgcttggtttgggtccatatccatttgcgcatgaagctgat
gcagatttaatcaatgcaggcaaggaaacagttactgttcttccaggagcctcttttttc
tccagcgatgaatcatttgcgatgattagagggggacatgtcgatttaacaatgctagga
gcaatgcaagtttccaaatatggtgacctagccaactggatgatacctgggaagatggtg
aaaggaatgggaggtgctatggatttagtgtccagtgccaaaaccaaagttgtggtcact
atggagcattctgcaaagggaaatgcacataaaatcatggagaaatgtacattaccactg
actggaaagcagtgtgtcaaccgcattattacagaaaaggctgtgtttgacgtggacaag
aagaaagggctgactctgattgagctctgggaagacctgacagtggatgacatacaaaag
agcactgggtgtgattttgcagtttcaccaaaacttatcccaatgcagcagatcacaact
tga

DBGET integrated database retrieval system