KEGG   Heterocephalus glaber (naked mole rat): 101718956Help
Entry
101718956         CDS       T02812                                 

Gene name
Erlin1, Erlin-1
Definition
(RefSeq) ER lipid raft associated 1
  KO
K23341  erlin
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hgl04121]
    101718956 (Erlin1)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    101718956 (Erlin1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 Catalase-rel DUF4346 Ribosomal_L33 PNISR
Motif
Other DBs
NCBI-GeneID: 101718956
NCBI-ProteinID: XP_004838716
UniProt: G5B0S6
Position
Un
AA seq 348 aa AA seqDB search
MNMTQARVFVASVVGLVVVLLYASIHKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITT
FRSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFN
KIHHELNQFCSAHTLQEVYIELFDQIDENLKQALQKDLNIMAPGLTIQAVRVTKPKIPEA
IRRNFELMEAEKTKLLIAAQKQKVVEKEAETERKKAVIEAEKIAQVAKIRFQQKVMEKET
EKHISEIEDAAFLAREKAKADAEYYAAHKYATSNKHKLTPEYLELKKYQAIASNSKIYFG
SNIPSMFMDSSCALKYSDVKTGRESSLLPEEALEPSGENPIQNKKSTG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgactcaagcccgggtttttgtggcttcagtggtgggactggtagttgtcctt
ctctacgcttccatccacaagatcgaggaaggacacctggctgtgtactacaggggagga
gctttactaactagccccagtggaccaggctatcatatcatgttgccttttattactacg
ttcagatctgtgcagacaacactacaaactgatgaagttaaaaatgtgccttgtggaaca
agtggtggggtcatgatctatattgatcgaatagaagtggttaatatgttggctccttat
gcagtgtttgatattgtaaggaactatactgcagattatgacaagaccttaatcttcaat
aaaatacaccatgagctgaaccagttttgcagtgcccacacacttcaagaagtttacatt
gaattgtttgatcaaatagatgaaaacctgaaacaagcgctgcagaaagatttaaacatc
atggccccaggtctcactatacaggccgtacgtgttacaaaacctaaaatcccagaagcc
ataagaagaaattttgagttaatggaggctgagaagactaaacttcttatagctgcacag
aaacaaaaggttgtggagaaagaagctgagacagagaggaaaaaggctgttatagaagca
gagaagattgcacaagtggccaaaattcggtttcagcagaaggtgatggagaaagaaact
gaaaagcacatttctgaaattgaagatgctgcctttctagcacgagagaaagcaaaagca
gatgctgaatattatgctgcacacaaatatgccacctcaaacaagcacaaattgaccccg
gaatatctggagctcaaaaagtaccaggccattgcttctaacagtaagatctactttgga
agcaatatccctagcatgttcatggactcctcttgtgctttgaaatattcagatgttaag
actggaagagaaagctccctgctccctgaggaggctcttgaaccctctggagagaacccc
atccaaaacaagaagagcacaggttga

DBGET integrated database retrieval system