KEGG   Heterocephalus glaber (naked mole rat): 101719685Help
Entry
101719685         CDS       T02812                                 

Gene name
Hsd17b2
Definition
(RefSeq) hydroxysteroid 17-beta dehydrogenase 2
  KO
K13368  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.239]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00140  Steroid hormone biosynthesis
hgl01100  Metabolic pathways
hgl04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101719685 (Hsd17b2)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    101719685 (Hsd17b2)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     101719685 (Hsd17b2)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     101719685 (Hsd17b2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR Epimerase NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 101719685
NCBI-ProteinID: XP_004842843
UniProt: G5BKQ7
Position
Un
AA seq 381 aa AA seqDB search
MIMVISEAAWFCLAVTAALGSIVFCKHKSPGQLGRPVVWLTGLCGGAYLLILSFFWSLVL
FSLLCFLMCMYLADQELLPVDQKAVLVTGCDSGFGHALAKNLDKLGFTVFAGVLNEKSSG
AEELRRNCSKHITVLQMDITNPEQIKDAHSKVIEKVQDKGLWALVNNAGILGFPTDGELI
PMIEYKKCMEVNFFGPVEVTKAFLPLLRKSKGRLVNVSSMGGVVPLPKFAAYNSTKAALT
MFSSIMRQELSAWGVKVSVVQPGGFRTNIAGTNDVWLKNEKDILDHLTQEQLRDYGRDYV
LLQKNFLNKFESFTCPDFTPVLRDIQHAISAQSPSPFYMPGKMVSLWVYFAFLSPTHLFD
YCVKKIFVKSEYIPRALHMPN
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgatcatggtcatctctgaggcagcatggttctgcctggctgtcactgcagccctaggc
agcatagttttctgcaaacacaagagcccagggcagctggggagaccagtggtctggctc
actggactctgcggaggggcttacctgctcatcttgtccttcttctggagcttggttctc
ttctccttgttgtgtttcctcatgtgtatgtacttggctgaccaagagctgttacccgtg
gatcaaaaggcagtcctggtgacaggttgtgattctgggttcggccatgcattggccaag
aacttggacaagctgggcttcacagtattcgctggagttttgaatgaaaagagctcagga
gctgaggaattgcgaagaaactgctccaagcacatcactgtgcttcagatggacatcacc
aacccagaacagataaaagatgctcacagcaaagtcatagagaaggtgcaggacaaagga
ctgtgggctctggtcaacaatgctgggatccttggcttcccgacagatggggaacttatt
cccatgattgagtacaaaaaatgcatggaggtgaacttctttggacccgtagaagtcacg
aaggcatttttacctcttcttaggaaatctaaggggaggctggtgaatgtcagcagcatg
ggaggagtggtcccattgccaaagttcgcagcttacaactcaacgaaggcagctctgact
atgttttcttcaattatgaggcaagaactttctgcatggggagtaaaagtctctgtggtc
cagcctggaggcttccgaacaaatattgcaggcacaaatgatgtatggctcaagaacgaa
aaggacatcctggaccacctcacccaagagcagctgagggactatggccgggactatgtt
cttctgcagaagaatttcctcaataagtttgaaagctttacctgcccagactttacccca
gtgctccgggacatccaacatgccatctctgctcagagcccgtctcccttctatatgccg
gggaaaatggtttccctgtgggtctactttgccttcctttcccctacccacttatttgat
tattgtgttaaaaaaatatttgtcaagagtgagtatattcccagagctctacacatgcct
aactag

DBGET integrated database retrieval system