KEGG   Heterocephalus glaber (naked mole rat): 101720541Help
Entry
101720541         CDS       T02812                                 

Gene name
Zdhhc15
Definition
(RefSeq) zinc finger DHHC-type containing 15
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101720541 (Zdhhc15)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     101720541 (Zdhhc15)
Membrane trafficking [BR:hgl04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    101720541 (Zdhhc15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 101720541
NCBI-ProteinID: XP_004867545
UniProt: A0A0P6JBG5
Position
Un
AA seq 337 aa AA seqDB search
MRRGWKMALSGGLRCCRQVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLIF
YHAIFVFFAWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLFDMAKKLPVY
TRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAY
SVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSR
NKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDNKKFWLIPIGSSPGDGHSFPMRSM
NESQNPLLANEELWEDNEDDNQDYPEGSSSLALETET
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggggctggaagatggctctgtctggggggctgcggtgctgccgccaggtactg
tcctgggtgccagtgctcgttattgtcctcgtcgtgctctggtcctactatgcctacgtc
tttgaactctgcctggtgactgttttgagcccagcagaaaaagttatctacctcatattc
taccatgccatctttgtgttttttgcctggacctactggaagtctatctttacactccca
cagcagccaaaccagaagttccacttatcctatacagacaaggagcgctatgaaaatgaa
gagagacctgaagtccagaagcagatgctcttcgatatggcaaagaagctgccagtttac
acaagaaccgggagcggagctgtacgattctgtgaccggtgccatctgatcaagccagac
cgctgccaccactgctctgtctgtgccatgtgtgttttaaaaatggaccatcactgccct
tgggttaataactgcattggattttccaactacaaattcttcctccagttcttagcttac
tccgttctctactgcctgtatattgctacaacagtcttcagctatttcatcaaatactgg
agaggggaattgcccagtgttcgctctaagttccatgtcctttttctcctctttgtggcc
tgcatgttttttgtcagccttgtgattctatttggttaccattgttggcttgtcagcaga
aacaaaactaccttagaggccttctgtactccagtgtttacaagtggcccagaaaaaaat
ggattcaaccttggcttcatcaaaaatatccagcaagtgtttggagataataagaagttc
tggttaatacctattgggtcaagtcctggcgatggacactccttccctatgaggtccatg
aatgagtcacagaacccactgctagcaaatgaagaactctgggaagataatgaggatgat
aatcaagattacccagaaggctcatcatctcttgccctcgagacggaaacatag

DBGET integrated database retrieval system