KEGG   Heterocephalus glaber (naked mole rat): 101722168Help
Entry
101722168         CDS       T02812                                 

Gene name
Insr
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04022  cGMP-PKG signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04520  Adherens junction
hgl04910  Insulin signaling pathway
hgl04913  Ovarian steroidogenesis
hgl04923  Regulation of lipolysis in adipocytes
hgl04930  Type II diabetes mellitus
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease (NAFLD)
hgl04960  Aldosterone-regulated sodium reabsorption
Module
hgl_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101722168 (Insr)
   04015 Rap1 signaling pathway
    101722168 (Insr)
   04010 MAPK signaling pathway
    101722168 (Insr)
   04066 HIF-1 signaling pathway
    101722168 (Insr)
   04068 FoxO signaling pathway
    101722168 (Insr)
   04072 Phospholipase D signaling pathway
    101722168 (Insr)
   04022 cGMP - PKG signaling pathway
    101722168 (Insr)
   04151 PI3K-Akt signaling pathway
    101722168 (Insr)
   04152 AMPK signaling pathway
    101722168 (Insr)
   04150 mTOR signaling pathway
    101722168 (Insr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101722168 (Insr)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101722168 (Insr)
   04923 Regulation of lipolysis in adipocyte
    101722168 (Insr)
   04913 Ovarian Steroidogenesis
    101722168 (Insr)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101722168 (Insr)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    101722168 (Insr)
   04213 Longevity regulating pathway - multiple species
    101722168 (Insr)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101722168 (Insr)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101722168 (Insr)
   04931 Insulin resistance
    101722168 (Insr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101722168 (Insr)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hgl04090]
    101722168 (Insr)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101722168 (Insr)
Protein kinases [BR:hgl01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   101722168 (Insr)
CD molecules [BR:hgl04090]
 Proteins
  101722168 (Insr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like DUF4476 B2
Motif
Other DBs
NCBI-GeneID: 101722168
NCBI-ProteinID: XP_004865373
Position
Un
AA seq 1381 aa AA seqDB search
MGAWGARGAATAPLLVAAAALLVGVTGHLYPGEVCPGMDIRNNLTRLHRLENCSIIEGHL
QILLMFKTKPEDFRDLSFPKLVMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYSLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTTKGKTNCPATVINGQFIERCWTHSHCQKVCPTMCKSHGCTTEGLCCHSECL
GNCSEPDDPTKCVACRNFYLDGRCVASCPPPYYHFQDWRCVNFSFCQELHNKCKNSRRQG
CHQYVIHNDRCIPECPSGYTMNSSNLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSSIRTSSDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKLQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDILYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVYWQ
RQEEDSELYELDYCLKGLKLPSRAWSPPFESEDAQKHNQSEYEESAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRNPSAGSGAQDPRPSRKRRSLGEVNVTTAVPLVPGFP
TLSSVSVPTNAEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDAPEERCSVAAYVS
ARTMPEAKADDIVGPVTHEIFDNNAVHLMWQEPKEPNGLIVLYEVSYRRYGEEELHLCVS
RKHYALEKGCRLRGLQPGNYSVRIRATSLAGNGSWTEATYFYVTNYSDVSSNIAKMIIGP
LIFVFLFSIVIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPCSVYVPDEWEVPRE
KITLLRELGQGSFGMVYEGNAKDIVKGEAETRVAVKTVNEAASLRERIEFLNEASVMKGF
TCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPESENNPGRPPPTLQEMIQMAA
EIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVR
WMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNC
PERVTDLMRMCWQFNPKMRPTFLEIVSLLKDDLHPSFPEVSFFHSEENKAPESEELEMEF
EDMENVPLDRSSHCQREEAGGREGGSSLGIKRNYEEHIPYTHMNGGKKNGRILPLPRSSP
S
NT seq 4146 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcctggggcgcgcggggggcggcgaccgcgccgctgctggtggccgcggccgcg
ctgctggtgggcgtcacgggccacctgtacccgggagaggtgtgtccgggcatggacatc
cggaacaacctcaccaggctgcacaggctggagaactgctccatcatcgagggacatttg
cagatcctcttgatgttcaagacgaagccagaagacttccgagacctcagtttccccaaa
ctggtcatgatcaccgattacttgctgctcttccgggtatatggccttgagagcctgaag
gacctgttccccaacctcacggtcatccgtggctcccgcctcttcttcaactacgcgctg
gtcatcttcgagatggtccatctgaaggagctggggctctacagcctcatgaacatcacg
cggggctccgtgcgcatcgagaagaacaatgagctctgctacttggccaccatcgactgg
tcccgcatcctggattctgtggaggacaactacatcgtgctgaacaaagatgacaatgag
gagtgtggagacatctgcccaggcaccacgaagggcaagaccaactgtcccgccactgtc
atcaacgggcaattcatagagcggtgctggactcacagtcactgtcagaaagtctgcccg
accatgtgcaagtcccacggctgtaccaccgaaggcctctgctgtcacagcgaatgcttg
ggcaactgctccgagcctgatgaccccaccaagtgtgtggcttgccgaaacttctacctg
gatggcaggtgcgtggcgtcctgcccgcctccctactaccacttccaggactggcgctgt
gtgaacttcagcttctgccaggagctgcacaataaatgcaagaactctcgcaggcaaggt
tgccaccagtacgtcattcacaatgacaggtgcatccctgagtgtccctctgggtacacg
atgaattccagcaacttgatgtgcaccccgtgcctgggcccctgccccaaggtctgtcac
ctcctggaaggcgagaaaaccattgactccgtcacgtcggcgcaggagcttcgaggctgc
actgtgatcaacgggagcctcatcatcaacatccggggaggcaacaacctggcagcagaa
ctggaggctaacctcggcctcattgaggagatttcagggtatctaaaaatccgccgatcc
tatgctcttgtatcactttccttcttccggaagttacgcttgattcgaggggaaaccttg
gaaatcgggaactactctttctatgccttggacaaccagaacctaaggcagctgtgggac
tggagcaaacacaacctcaccatcactcaggggaaactcttcttccattataatcccaaa
ctctgcctgtcagaaatccacaagatggaagaagtttcgggaaccaaggggcgccaggag
aggaacgacattgccctgaagacgaacggggaccaggcatcttgtgaaaatgaattactt
aaattttcatccattcggacaagttctgacaagatcttgctgagatgggagccctactgg
ccccccgacttcagggacctcttaggattcatgctcttctacaaagaggccccttatcag
aacgtgaccgagtttgacgggcaggatgcgtgtggctccaacagctggaccgtggtggac
atcgacccgcccttgagatccaatgaccccaagttgcagaaccaccctgggtggctgatg
agaggtctcaagccctggacccagtacgccatctttgtcaagaccttggtcaccttttct
gacgagcgccggacgtatggggccaagagcgacatcctctacgtgcagacggatgccacc
aacccgtctgtcccgctggaccccatctccgtgtcgaattcttcatcccagataattttg
aagtggaagcctccctcggaccccaacggcaacatcacgcactacctggtttactggcag
aggcaggaggaagacagtgagctgtacgagttggattattgcctcaaagggctgaagctg
ccctcccgggcgtggtccccgcccttcgagtctgaggatgcccagaaacacaaccagagc
gagtacgaggagtcggcgggcgagtgctgctcctgccccaagaccgactctcagatcctc
aaggagctggaggagtcttcgttccggaagaccttcgaggattacctgcacaacgtggtc
ttcgtgcccagaaatccctctgcaggcagtggtgcccaggaccctaggccctcgcggaag
cgcaggtccctgggtgaggtgaatgtgaccacagcggtgcccttggtaccgggtttcccc
accctctcctccgtcagcgtgcccaccaacgcggaggagcacaggcccttcgagaaggtg
gtgaacaaggagtccctggtcatctctggcctgcgacacttcaccggctatcggattgag
ctgcaggcctgcaaccaggatgctccggaggagaggtgcagcgtggctgcctatgtcagc
gccaggaccatgcccgaagccaaggcggatgacatcgtcggccctgtgacgcacgaaatc
tttgataacaacgctgttcacttgatgtggcaagaaccaaaggaacccaatggcctgatc
gtgctgtatgaagtgagttatcggcggtacggggaagaggagctgcacctgtgtgtctcc
cggaagcactacgccctggagaaggggtgcagactgcgggggctgcagccaggcaactac
agcgtgcggatccgggccacctccctggcggggaacggctcctggacggaagccacctat
ttctacgtgacaaattattcagatgtctcatcaaacattgcaaagatgatcattggtccc
ctcattttcgtctttctcttcagtattgtgattgggagtatttatctattcctgaggaag
agacagccggatgggccaatgggaccgctgtacgcctcctcgaaccctgagtacctcagc
gccagtgacgtatttccctgttctgtgtatgtgccggacgagtgggaggtccctcgagag
aagatcaccctcctgagagagctggggcagggctcctttggcatggtatacgagggaaat
gccaaggacatcgtcaagggtgaggcagagactcgagtggcggtgaagacggtcaatgaa
gcagccagtctccgagagaggatcgaattcctcaacgaggcctccgtcatgaaaggcttc
acatgtcatcacgtggttcgcctcctgggagtggtgtccaagggccagccaacgctggtg
gtgatggagttgatggcccatggagacttgaagagctacctccgctccttgcggccagag
tctgagaataaccccggccgccctccccctactctacaagagatgattcagatggcggcg
gagattgccgatgggatggcgtacctgaatgccaagaagtttgtgcaccgagacctggca
gctcgaaactgcatggttgcccatgattttactgtcaaaatcggagactttggaatgacc
agggacatctacgaaacggattactaccggaaagggggcaaaggtctgctccctgtgcgg
tggatggcaccggagtccctgaaagatggggtcttcaccacttcctccgacatgtggtcc
tttggtgtagtcctttgggaaatcaccagcttggcagaacagccttaccaagggctgtct
aatgaacaggtgttgaaatttgtcatggatggagggtatctggaccagcctgacaattgt
ccagagagagtcactgacctgatgcgcatgtgctggcagttcaaccccaagatgcggccg
accttcttggagatcgtcagcctgctgaaggatgaccttcatcccagcttcccagaagtc
tccttcttccacagcgaggagaacaaggcccctgagagtgaggagttggagatggagttc
gaggacatggagaatgtccccttggatcggtcctcacactgtcagagggaggaggccggg
ggccgggagggagggtcctcgctgggcatcaagcggaactatgaagagcacatcccgtac
acccacatgaacgggggcaagaagaacgggcggatcctgcccctgccccggtccagccct
tcctaa

DBGET integrated database retrieval system