KEGG   Heterocephalus glaber (naked mole rat): 101722212
Entry
101722212         CDS       T02812                                 

Gene name
Dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00230  Purine metabolism
hgl00240  Pyrimidine metabolism
hgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101722212 (Dck)
   00240 Pyrimidine metabolism
    101722212 (Dck)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     101722212 (Dck)
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 AAA_33 DUF932 AAA_17
Other DBs
NCBI-GeneID: 101722212
NCBI-ProteinID: XP_004871800
UniProt: A0A0P6JEE1
Position
Un
AA seq 261 aa
MATPPKRVCPSPTPSSEGSRGVTKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWC
NVQSTQGEFEELTTSQKSGGNVLQMMYAKPERWSFTFQSYACLSRIRAQLSSVNGKLKDA
EKPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLR
AAPEKCLNRIHSRGRTEEQGIPLEYLEKLHYKHESWLLHRTLKTNFEYLQEVPILTLDVN
EDFKDNHESLVEKVKEFLSTL
NT seq 786 nt   +upstreamnt  +downstreamnt
atggccactccgcccaagagagtgtgcccgtcccctacgcccagctccgagggctcccgc
ggcgtcacgaagatctccattgaagggaacatcgctgcgggaaagtcaacatttgtgaat
atcctaaagcaagtctgcgaggactgggaggtggttcctgagcctgttgccagatggtgc
aacgttcagagcactcaaggtgaatttgaggaactgacaacctctcagaaaagtggtggg
aatgttcttcagatgatgtatgcaaaacctgaacgatggtcttttaccttccaatcctat
gcttgtctcagtcgaatacgtgctcagctctcctctgtcaatggcaagctcaaagatgca
gagaaacctgtgttattttttgagcgatctgtgtatagtgacaggtacatttttgcatct
aatttgtatgaatctgactgcatgaacgagacagagtggacaatatatcaagactggcat
gactggatgaataaccagtttggccaaagtcttgaactggacggaatcatttatcttcga
gctgctccagagaaatgcttgaataggatacattcacgaggaagaactgaagagcaaggc
atccctcttgaatatttagagaagcttcactataagcacgaaagctggctcctgcatagg
acactgaaaaccaactttgagtatctgcaagaggtgcctattttaacattggatgttaat
gaagacttcaaagacaatcatgaaagtctagttgaaaaggtcaaagaatttttgagcact
ttgtga

DBGET integrated database retrieval system