KEGG   Heterocephalus glaber (naked mole rat): 101722954Help
Entry
101722954         CDS       T02812                                 

Gene name
Blvra
Definition
(RefSeq) biliverdin reductase A
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00860  Porphyrin and chlorophyll metabolism
hgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101722954 (Blvra)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     101722954 (Blvra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biliv-reduc_cat GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-GeneID: 101722954
NCBI-ProteinID: XP_004840618
Position
Un
AA seq 277 aa AA seqDB search
MNAQPERKFGVVVVGVGRAGSLRMRDLRSPHESSALLNLIGFVSRRELGNIDGVQQISLE
DALSTREVEVAYICSESTSHEGHIRQFLDAGKHVLVEYPMTLSLVAAQELWALAEQKGKV
LHEEHVELLMEEFAFLKKEVVGKELLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLF
GELSLVSATLEDPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFV
QKLLGQVSEKELAAEKKRILHCLALAEEIQKFCHSKK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacagcctgagaggaagtttggcgtggtggtggtcggtgttggcagagctggc
tccctgcgaatgagggacttgcggagtccacatgagtcctcggcactcctgaacctgatt
ggcttcgtgtccagacgggagcttgggaacattgatggcgttcagcagatttctttggaa
gatgctctctccacccgggaggttgaagttgcctacatctgcagtgaaagcaccagtcac
gagggccacatcaggcagttccttgacgccggcaagcacgtcctcgtcgagtaccccatg
acgctgtctctggtggcagctcaggagctgtgggccctggcggagcagaaaggaaaagtc
ttgcacgaggagcatgtggaactcttgatggaggaatttgcattcctgaaaaaagaagtg
gtgggaaaagagctgctgaaaggatcccttctcttcacagctggccccctggaagaagag
cggtttggcttccctgccttcagtggcatctctcgcctgacctggctggtctctctcttt
ggggagctttctcttgtgtctgccactctggaagacccgctgtcatggattgaagagaaa
gggcctggtctaaaacgaaacagatatttaagtttccatttcaaatctgggtccctggag
aatgtgccaaatgtgggagtcaataagaacatttttctgaaagaccaaaatatatttgtc
cagaaactcttgggccaagtctctgagaaggagctggctgctgaaaagaaacgcatccta
cattgcctggcactggcagaagaaatccagaagttctgccactcaaagaagtaa

DBGET integrated database retrieval system