KEGG   Heterocephalus glaber (naked mole rat): 101723003
Entry
101723003         CDS       T02812                                 

Gene name
Ankrd53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hgl03036]
    101723003 (Ankrd53)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    101723003 (Ankrd53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 101723003
NCBI-ProteinID: XP_004850121
Position
Un
AA seq 524 aa
MELFRFPQQQVPDALAAQPAAKTTPRGERQVALPAPSSRGLPRPPCSASARARTRTLDPG
GEEWRGVQPGSGQRAEKVFLKVTPSDLESTRSSASISESSRNHSQLFAAAVGNVEWLRFC
LNRDRREIQSDCKGFTAIHFVAQRGKFTCMKVLIEEYKVPVDLPTYSSQTPLHLVMHKDN
KTTAVPCILYLLKKGASINSXVQQRLQPLHLAAPEGLLGCMKTLVQSGANVHAQNATGCK
PIDFCKIWKHRACARFLKDAMWKQDKKDFACEMRKLKRLKDQLTLMEHNYLLEYQKEHQL
LREADFRKWLHRKLLQSPVSNPKQEPGAPTCPIVLSETPGSQISKSFYRFVEARLKSMPQ
PRVPPKPVYTQPKISQPKLWNLSNNPTRSQPLSISCPQDSRLGVHSDPCQEHDFCGFVEV
TRNPHGSAQLRTVDSHWVAPVPQLPFEVMVCMLHPGVRPHRMKVPQGIYVKSILDVPQRR
HLSQDTFWTDTMAMNLHETFDEAFLATMRAHQGLAALPSSPAAL
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggagctgtttcgctttccgcagcagcaggttcctgacgccctggcggcgcagccagcg
gcaaagacgacgccccgaggggagcgacaggtggcgctccccgccccatccagccgcgga
ctccctcggcctccgtgctcggcctctgccagggcgcggacaaggaccctggacccggga
ggggaagaatggagaggagtgcagcctggctccgggcagcgggcggagaaagtgttcctg
aaggtcaccccaagtgacctagagagcacgcggtccagcgcctccatctctgagtcgtcc
aggaaccactcccagctgtttgcggccgcggtgggcaacgtggaatggctgcgattctgt
ctgaatcgggaccgcagggagatccaaagcgactgcaaggggttcactgccatccacttc
gtagcccagcggggcaagttcacatgcatgaaggtcttaatagaggagtataaggttccc
gtggacctgcccacctacagtagccagacccccttgcatcttgtcatgcacaaggacaac
aagaccacagctgtcccctgcattctctacttgctcaagaagggggcctccatcaacagt
tgagtccagcaacggcttcaacccttgcacctggcagccccagaaggcctgctgggctgc
atgaagaccctggtacagagtggtgccaatgtccatgcccaaaatgccacaggctgcaag
cccatcgacttctgcaaaatatggaagcaccgtgcctgtgcccggttcttgaaagatgcc
atgtggaaacaggacaagaaggattttgcttgtgagatgaggaaactgaagcgcctcaag
gaccagctgacactcatggagcataactacctgcttgagtatcaaaaagaacaccaactt
ctgagagaggctgatttcaggaagtggctccatcgaaagctgcttcaatcaccggtctcc
aaccctaagcaagagcctggtgccccaacttgccccattgttctctctgagaccccagga
tcccagatttccaagagcttctaccgcttcgtggaggcccgcctgaaaagcatgcctcag
ccaagggtgccacccaagccagtctacacccagcctaaaatcagtcagcccaagttgtgg
aatcttagcaataaccctaccagatcccagcccctcagcatcagctgcccacaggacagc
cgtctaggtgttcattcagacccctgccaggagcacgacttctgcggcttcgtggaggtg
acccggaacccacatggtagtgcacaactgcgcacggtggatagtcactgggtggcacct
gtaccccagctcccttttgaggtgatggtctgcatgctgcaccctggggtgcggccacac
aggatgaaggtgccccaggggatttatgtcaagagcatactggatgtaccccagaggcgg
cacttgagccaggacaccttctggactgacactatggccatgaacctgcatgagacattt
gatgaagccttcctggcgaccatgcgagctcatcaagggctcgctgccttgccctcctct
ccagccgccttataa

DBGET integrated database retrieval system