KEGG   Heterocephalus glaber (naked mole rat): 101723302
Entry
101723302         CDS       T02812                                 

Gene name
Apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04080  Neuroactive ligand-receptor interaction
hgl04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101723302 (Apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101723302 (Apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 101723302
NCBI-ProteinID: XP_004860093
Position
Un
AA seq 77 aa
MNLRLCVQALLLLWLSLTVVCGVPLMQPPEGKGLEQGSIRYLVQPRASRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctctgcgtgcaggcgctgctgctgctctggctctccttgactgtggtg
tgtggagtgcccctgatgcagcctcctgaagggaaggggctggagcaaggcagcattcgc
tatctggtgcagcccagggcttcaaggaatggaccagggccctggcagggaggccggagg
aagttccgccgccaacggccccgcctctcccataagggccccatgcctttctga

DBGET integrated database retrieval system