KEGG   Heterocephalus glaber (naked mole rat): 101724285Help
Entry
101724285         CDS       T02812                                 

Gene name
Cpt1b
Definition
(RefSeq) carnitine palmitoyltransferase 1B
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00071  Fatty acid degradation
hgl01212  Fatty acid metabolism
hgl03320  PPAR signaling pathway
hgl04152  AMPK signaling pathway
hgl04714  Thermogenesis
hgl04920  Adipocytokine signaling pathway
hgl04922  Glucagon signaling pathway
hgl04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101724285 (Cpt1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101724285 (Cpt1b)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101724285 (Cpt1b)
   04920 Adipocytokine signaling pathway
    101724285 (Cpt1b)
   03320 PPAR signaling pathway
    101724285 (Cpt1b)
  09159 Environmental adaptation
   04714 Thermogenesis
    101724285 (Cpt1b)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101724285 (Cpt1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hgl03029]
    101724285 (Cpt1b)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     101724285 (Cpt1b)
Mitochondrial biogenesis [BR:hgl03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101724285 (Cpt1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 101724285
NCBI-ProteinID: XP_004845344
Position
Un
AA seq 783 aa AA seqDB search
MAEAHQAVAFQFTVTPDGVDFRLSREALKHIYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLAIVMATVGFSYCEVDISMGLVCCIQRCLPERCGPYQTPQTRALLSMAIFSTGVWVTG
IFLFRQTLKLLLSYHGWMFEMHGKTSHFTKIWAIGVRLLSSQRPMLYSFQTSLPKLPVPG
VRATIQRYLESVQPLLDDEEYYRMETLAKEFQDKTAPRLQKYLILKSWWATNYVSDWWEE
YIYLRGRTPLTVNSNYYVMDLVLVKNTDVQAARLGNAVHAMIMYRRKLDREEIKPVMALG
MVPMCSYQMERMFNTTRIPGKETGLASACPLAITDVLQHLAESRHVAVYHKGRFFKVWLY
EGSRLLKPRDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQTFFSSGKNKASL
DAIERAAFFVALDEESHCYSPDDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGVLGL
NTEHAWADAPIIGHLWEFVLGTDTLHLGYTESGHCLGEPNPMLAPPQRLQWDIPEQCQAV
IESSYQVAKALADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDKGKFCLTY
EASMTRMFREGRTETVRSCTSESKVFVQAMTKGPHVKADLQNLFRKASEKHQNMYRLAMT
GAGIDRHLFCLYLVSKYLGVRSPFLAEVLSEPWRLSTSQIPQSQIRMFDPNQYPNYLAAG
GGFGPVADDGYGVSYMIAGENTIFFHVSSKFSSSETNAQRFGNHIRQALLDIADLFQVPK
ANN
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcacaccaggccgtggccttccagttcaccgtgaccccagacggggtggac
ttccggctcagtagggaagccctgaaacacatctacctgtccgggatcaactcctggaag
aaacgcctgattcgcatcaagaatggcattcttaggggtgtgtaccctggcagccccacc
agctggctggccattgtcatggcaacggtgggtttctcctactgcgaagtggacatctct
atggggctggtctgttgtatccagaggtgcctccctgagaggtgtggcccctaccagacc
ccacagactcgggcacttctcagcatggccatcttctccacaggggtctgggtgacaggc
atcttcttattccgccaaaccctgaagctgctgctttcctaccatgggtggatgtttgag
atgcatggcaagaccagccacttcaccaagatctgggctatcggtgttcgccttctgtcc
agccagcggcccatgctctacagcttccagacatctctgcccaagcttcctgtgcccggc
gtgcgagccacaattcagaggtacctggagtctgtgcagcccttgttggatgatgaggaa
tattaccgcatggagaccttagccaaagaattccaggacaagactgcccccaggctgcag
aagtacctgatactcaagtcgtggtgggcaactaactacgtgagtgactggtgggaagag
tacatctacctcagaggcagaaccccactcacggtgaacagcaactattacgtgatggac
cttgtgcttgtcaagaacacagatgtgcaggctgcccgcctgggaaatgctgtccatgcc
atgatcatgtatcgtcgcaaactggaccgtgaagagatcaagcctgtgatggcactaggc
atggtgcccatgtgcagctaccagatggaaaggatgttcaacaccactcgcatccctggc
aaggagacaggccttgcctcagcctgcccactggccatcacagatgtgttgcagcacctc
gcggagagcagacacgtggccgtctaccacaagggccgcttcttcaaggtgtggctctat
gagggctctcgcctgcttaagcctcgggacttggagatgcagttccagaggatcctggac
gacccctccccacctcagcctggggaggaaaagctggcggccctcactgcagggggaagg
gtagagtgggcacaggcacgccagaccttcttcagctctggcaagaacaaggcttctctg
gatgccattgagcgcgctgctttctttgtggccctggacgaggagtcccactgctacagc
cctgatgatgaggccagtctcagcctgtatggcaaggctctgctacatggcaactgctac
aacaggtggtttgacaagtctttcactcttatttccttcaagaatggtgtgttgggcctc
aacacagaacatgcatgggcagatgcccctattattgggcatctatgggagtttgtccta
ggcacggacaccttacacctgggctacacagaaagtgggcactgcctgggcgaaccaaac
ccgatgttggcacctcctcagcggctccaatgggacattcctgagcagtgtcaggctgtc
atcgagagttcctaccaagtagccaaggcactggcagacgatgtggagttgtactgcttc
cagttcttgccctttggtaagggccttatcaagaagtgtcggaccagccctgatgccttc
gtgcaaattgccctgcagctggctcacttccgggacaagggcaagttctgcctgacctat
gaggcctcaatgaccagaatgttccgagaaggccggaccgagactgtgcgttcttgtacc
agcgagtctaaagtctttgtgcaggccatgacgaaggggccccacgtgaaagcagacctc
caaaatctcttccggaaagcttcagagaagcaccagaacatgtaccgcctagccatgacg
ggcgctggcattgacaggcacctcttctgcctttacttggtctctaagtacctgggggtc
cgctccccattcctggcagaggtgctatcggaaccctggcgcctctccaccagccagatc
cctcagtcccagatccgcatgtttgacccaaaccagtatcccaattacctggccgcagga
ggtggctttggccctgtggcagatgatgggtatggggtctcctatatgattgcaggtgaa
aacaccatcttcttccacgtctctagcaagttctcaagttcagagacgaatgctcaacgc
tttgggaaccacatccggcaagccctgttggacatcgctgatcttttccaagttcccaaa
gctaacaactga

DBGET integrated database retrieval system