KEGG   Heterocephalus glaber (naked mole rat): 101724302Help
Entry
101724302         CDS       T02812                                 

Gene name
Neu4
Definition
(RefSeq) neuraminidase 4
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00511  Other glycan degradation
hgl00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    101724302 (Neu4)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101724302 (Neu4)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     101724302 (Neu4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 101724302
NCBI-ProteinID: XP_004868566
UniProt: G5C3S7
Position
Un
AA seq 457 aa AA seqDB search
MGSPRVPARTVLFRRERTGLTYRVPALLCIPPRPTLLAFAEQRQSPDDAHAHRLVLRRGA
LAAGGVRWGALRVLATAALEEHRSMNPCPVTDAGSGTVFLFFIAVLGHTPEAVQIATGRN
AARLCCVTSHDAGLTWGGARDLTEETLGAQAQDWATFAVGPGHGIQLPSGRLLVPAYTYR
VDRRECFGKICRTSPHSFAIYSDDQGRTWHCGGLVPNLRSGECQLAAVGGSFLYCNARSP
LGSRVQSLSADEGTSFLPAELVPTLAETARGCQGSIVGFPAPTPSREEEPNPPHLCPGVQ
DPLSGPFCHPQPWENSQEQPGPEPGLGGDGEAYTPMLPLPSVAPAQSPTWLLYSHPVGHR
ARLRMGIYLSRSPLDPHSWTEPWVIYEGPSGYSDLATLGSGPGAALAFACLFESGVRASY
EDISFCMFSLREVLENVSGGPEMLHRSGKPWEHCRPS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgggctctccgcgtgtccccgcgaggaccgtgcttttccggcgcgagaggaccggcctg
acctaccgcgtgccggcgctgctgtgcataccgcctcggcccacgctgctggccttcgcg
gagcaacggcagagccccgacgacgcccacgcgcaccgcctggtgctgcggcgaggcgcg
ctggccgcgggcggcgtgcggtggggcgccctgcgcgtgctagcaacggccgccctggag
gagcaccgctccatgaacccctgtcccgtgactgacgcgggctcgggcacagtcttcctc
ttcttcatcgcggtgctgggccacacgcccgaggccgtgcagatcgccacgggcaggaac
gcggctcgcctctgctgcgtgaccagccacgacgcgggcctcacctggggcggcgcgcgg
gacctcacggaagagaccctgggtgcccaggcgcaggactgggccacctttgctgtgggc
cctggccacgggatccagctgccctcaggtcggctgctggtgcctgcctacacttaccgt
gtggaccgccgggaatgctttggcaagatctgccggaccagcccccactcctttgccatc
tacagtgatgaccagggccgcacctggcactgtgggggcctggtgcccaacctgcgttca
ggcgagtgccagctggctgccgtgggtgggagcttcctctactgcaatgcccggagtccc
ctgggcagccgtgtgcagtcacttagcgctgatgagggcacctccttcttgcctgcggag
cttgtgcccaccctggcagagactgcccggggctgccagggcagcatcgtaggttttcca
gctcccacccctagcagggaggaggagccaaaccctcctcatctgtgtcctggagtccag
gatcccctcagtgggcccttctgccacccacagccctgggagaacagccaggagcagcct
ggcccggagcctgggcttggtggggatggggaggcctacaccccaatgctccccttgccc
tctgtggccccagcacagagccccacatggctgctgtattctcacccagtggggcacaga
gctcggctccgcatgggcatctacctgagccggtcccccctggacccccacagttggacg
gagccctgggtgatctatgaaggccccagtggctactctgacctggcaacccttgggtct
gggcctggggcagccctggcctttgcctgtctattcgagagtggggtcagggcctcctac
gaagatatctccttctgcatgttctctttgcgagaggtcctggagaatgtgtcagggggc
cctgagatgctccatcgttcgggcaagccctgggaacactgccggccctcctga

DBGET integrated database retrieval system