KEGG   Heterocephalus glaber (naked mole rat): 101724999
Entry
101724999         CDS       T02812                                 

Gene name
Ahrr
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101724999 (Ahrr)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101724999 (Ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 101724999
NCBI-ProteinID: XP_012927796
Position
Un
AA seq 836 aa
MFSPCDSQNAATERGSGQAIPSAAHTSAQRGSGCEGPTLRADARRRGQRRARPGLPTAST
GDPTPRAETQGHGTEPCAPPAAAAAAAGLSGRGAGRGGASSAPPRPRDAAPTAARPQLPA
CGSPAAPASGSGPAACPAVATLSAIMGQALASKFRLVVWLMTLSRRLQMETLVHLRPRPA
VGAETSNPSKRHRDRLNAELDHLASLLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQAVQ
ETRTLSPGDSPQGGAPVQEGQLLLESLNGFALVVSAEGMIFYASATIVDYLGFHQTDVMH
QNIYDYIHVDDRQDFCRQLHWAMDPPQAGCGQPPHMEADNTVLGRLLRAQEGGMGSPTEY
SAFLTRCFICRVRCLLDSTSGFLMMQFQGKLRFLLGQKKKAPSGAVLPPRLALFCTVVPV
LLPSTAEMKMKSTYLRVKHRAEVPAMTDTRAKATVSLCEPELHGKPSYLAGRNGENSISM
FRAQTDACHWARVPARARCPCLRGGMDLILDSKGATRDREETEQDRMPSGSTGGRTRREL
HVYNCRQETPAPGRYLNWTTEKCEQEGGTKLKPLPGRSEPLSMCTASPGSCLPPPGTEGM
FSASSLATFRNPPGHVPSAYCGRMSRAWRDVSQGQAPPPACRTGAQRFTSGGYCTEDAKP
AGLLMPPGTPCNPMLALEVPIKMENDSGSEDTADGCTPSQVWLGASDVTKRHLVTFPTRM
HLKAEPECRHQVYSQPLSVGMLAAHPQSKVTAGLCRELAPFYPAHNSCLELGPPRHFCTL
GHSECRAPEVTPLVKREPLDSPPWAAAGQGAVPGVFPKSAAAVQIPPSAPEAPFLL
NT seq 2511 nt   +upstreamnt  +downstreamnt
atgttcagtccttgtgattcccaaaatgccgccacggagcgcgggagtggacaggcgatt
ccttccgctgcccacacgagtgcgcagcgtggctccgggtgcgaggggcccacgctgcgg
gcggacgccaggcgccggggacagaggagggcgaggcctgggcttccgacggcgagcacg
ggggaccccaccccgcgcgcggagacccagggccacgggaccgagccgtgcgcgccccct
gccgccgccgccgccgctgccgggctctcggggcggggcgcgggccggggtggtgcctcc
tccgccccgccccgtccccgggatgcggcgcccactgccgcgcggccacagctcccggcg
tgcggctcccccgcggcgccggcctcggggtctggtccggcggcctgtccagctgtggcc
actctgagcgccatcatggggcaggctctggcctcaaagttccggcttgtggtctggttg
atgaccctcagcaggagactccagatggagacactggtccacctccgcccgaggcctgcc
gtgggggccgagacgtcgaatccctccaagcggcaccgggaccgcctcaacgcggagctg
gaccacctggccagcctgctgcccttccctcctgacatcatctccaagctggacaagctg
tccgtcctgcgcctcagcgtcagttacctccgggtgaagagcttcttccaagccgtgcag
gagactcgcaccctctcacctggagacagcccacaaggaggggcccccgtgcaggagggg
cagcttctgctggagtctctcaatggcttcgctctggttgtgagtgcagaagggatgatt
ttttacgcatcggccacgattgtggactatttgggcttccaccagacagacgtaatgcac
cagaacatttatgactacatccacgtggatgaccgccaggacttctgccggcagctccac
tgggccatggatcccccacaggcgggttgtgggcagcccccacacatggaggcagacaac
acggtcctggggaggttgctcagggcccaggaagggggcatgggctcacccactgagtac
tcagccttcctgacacgttgcttcatctgccgtgtacgctgcctactggatagcacctcc
ggttttctgatgatgcagtttcaaggaaaactaagattcctgttgggacagaagaagaag
gcgccgtcgggagcggtcctgcccccacggctcgcgctgttctgcaccgtggtgccagtc
ctcctgccctccacagcggagatgaaaatgaagagcacatatctgagggtgaagcacagg
gcagaggtgccagccatgacagacacaagggcaaaagcgaccgtgagtctgtgtgaacca
gaacttcatggaaaacccagctacttagcaggaaggaatggtgaaaacagcatctcaatg
ttcagggcacaaacggatgcctgccactgggcccgggtcccagccagggctcgatgcccc
tgcctcagggggggcatggacctcatcctggattccaagggggcaacaagggacagggaa
gaaacagagcaggacaggatgccgagtggctccacaggagggaggacacggagggagctg
catgtgtacaattgccgtcaagagacaccagcacccgggcggtacctgaactggaccaca
gaaaagtgtgagcaggaaggcggcaccaagctgaagccactgccaggcaggagtgagccc
ctctccatgtgcaccgcatccccaggctcctgcctgccccccccaggcaccgagggcatg
ttcagtgccagcagcctggctaccttcagaaatcctccaggccatgtccccagtgcctac
tgtggccggatgagcagagcctggcgggatgtctctcagggccaggcgcccccacctgcc
tgccgcactggagcgcagcgcttcacctctggtggctactgcacagaggatgcgaagcct
gctggcctgctgatgcccccaggtaccccgtgcaatcccatgctggcactggaggtacca
atcaagatggaaaatgactctgggtcggaggacacagcagatggttgcacccctagccaa
gtgtggctgggagccagtgatgtcaccaagagacatctggtcactttccccaccaggatg
cacctgaaagcagagccagagtgcaggcaccaggtctatagccagcccctcagtgtgggc
atgctggcagcccaccctcagagcaaggtcactgccgggctctgccgggagctggccccg
ttctaccctgcacacaactcctgccttgagctagggccgccccgccacttctgcaccctg
ggccacagtgagtgcagggcaccggaggtcacacccttggtcaagcgtgaacccctggac
tcacccccatgggctgcagcgggccagggtgctgtgcccggggtcttccccaaaagtgct
gctgctgttcagattccacccagcgctcctgaggctcctttcctgctgtag

DBGET integrated database retrieval system