KEGG   Heterocephalus glaber (naked mole rat): 101725528Help
Entry
101725528         CDS       T02812                                 

Definition
(RefSeq) liver carboxylesterase 1
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00983  Drug metabolism - other enzymes
hgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101725528
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     101725528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 101725528
NCBI-ProteinID: XP_004847962
Position
Un
AA seq 566 aa AA seqDB search
MWLYTLVFAFLTTFTVWAGHTSSPPVVDTMHGKVLGKYVSLDGFAQPVAVFLGVPFAKPP
LGSLRFAPPEPAEPWSSVKNTTSYPPMCSQDAVAGQVLSELFTNRKEDIPLKFSEDCLYL
NIYTPADLTKKSRLPVMVWIHGGGLVVGGASTYDGVPLSAHENIVVVTIQYRLGIWGFFS
TGDEHSRGNWGHLDQVAALHWVQDNIANFGGNPGSVTIFGESAGSQSVSVLVLSPVAKNL
FHKAISESGVALIAALFRKDIKPLAEKIAVTAGCKTTTSAIMVHCLRQKTEDELLETTLK
MNFFSVDFFGDPREGHPFLPTVVDGVVLSKTPKEILEEKNFHTIPYIVGINKQEFGWILP
MMMGYPISEGKLDQQTAASLLWKSYSILNIPEELTPVVTEKYLGGTDDHFKKKDLFLDLI
ADLVFGVPAVTVARSHRDARAPTYMYEFQYQPSFSSSMKPKTVIGDHGDELFSVFGAPFL
KDGASEEEINLSKMMMKFWANFARNGNPNGEGLPHWPEYDQKEGYLQIGATTQAAQGLKA
KEMVFWNEFWAKEAMRKPTQREHIEL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtggctctatactctggtcttcgcctttctcaccactttcaccgtttgggcagggcac
acatcctcgccacctgtggtggacaccatgcatggaaaggtcctggggaagtatgtcagc
ctggatggatttgcccagcctgtggcagtcttcctgggagtcccttttgccaaaccccct
cttggatccctgaggtttgctcctccagaacctgcagagccatggagctctgtgaagaac
accacctcgtatcctcctatgtgctctcaagatgcagtggcagggcaggtgttgtcagag
ttgtttaccaacagaaaggaggacattcctctcaagttttctgaagactgtctgtaccta
aatatttacactcctgctgacttgacaaaaaaaagcaggctgccggtgatggtctggatc
catggaggtggtcttgtggtgggcggggcatccacctatgatggagtgcccctttctgcc
catgaaaacatagtggtggtaaccattcagtaccgcctgggcatctggggattctttagc
acaggtgatgaacacagccgagggaactggggtcacttagaccaggtggctgcgctgcac
tgggtccaggacaacattgccaactttggagggaacccaggctctgtgaccatctttgga
gagtcagctggtagtcaaagtgtttctgttcttgtgttatctcctgtagctaaaaacctc
ttccacaaggccatttctgaaagtggtgtggccctcattgctgctctgttcaggaaggac
atcaagcctttggctgagaaaattgctgttactgctgggtgcaaaaccaccacatcagcc
atcatggttcattgcctgcgacagaagacagaggatgagctcttggagacaactctgaaa
atgaatttttttagtgtggatttttttggagaccccagagagggccatcctttcttgccc
actgtagttgatggagtagtactgtcaaagacacctaaagagattctggaagaaaagaat
ttccacaccatcccctacatagtgggaatcaacaagcaagagtttggctggatccttcca
atgatgatgggctatccaatctctgaaggcaagctggaccagcagacagccgcatcactc
ttgtggaagtcctactccattcttaacatccctgaggaactgactcctgtggtcaccgag
aagtatttaggagggacagatgatcatttcaaaaagaaagacctattcctggacttgatt
gcagacttggtatttggtgtccctgctgtgactgtggctcgtagccacagagatgccaga
gcccccacctacatgtatgagttccagtatcaaccaagcttctcatcatccatgaaaccc
aagaccgtgataggagaccatggagatgagctcttctcagtatttggtgctccattttta
aaagatggtgcctcagaagaggagatcaacctcagcaagatgatgatgaaattctgggcc
aactttgctcgcaatgggaaccccaatggggaaggtttgccccattggccagagtatgac
cagaaggaaggatacctgcagattggtgctaccactcaagcagcccaggggctgaaagca
aaggaaatggttttctggaatgagttctgggccaaggaagcaatgaggaagccaacccag
agagaacatattgagctctga

DBGET integrated database retrieval system