KEGG   Heterocephalus glaber (naked mole rat): 101726082
Entry
101726082         CDS       T02812                                 

Gene name
Riox2, Mina
Definition
(RefSeq) ribosomal oxygenase 2
  KO
K21760  bifunctional lysine-specific demethylase and histidyl-hydroxylase MINA [EC:1.14.11.-]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hgl03009]
    101726082 (Riox2)
   03036 Chromosome and associated proteins [BR:hgl03036]
    101726082 (Riox2)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     101726082 (Riox2)
Ribosome biogenesis [BR:hgl03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    101726082 (Riox2)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    101726082 (Riox2)
SSDB
Motif
Pfam: Cupin_4 Cupin_8 Cupin_2 AraC_binding
Other DBs
NCBI-GeneID: 101726082
NCBI-ProteinID: XP_004857986
UniProt: G5BXD4
Position
Un
AA seq 463 aa
MPKKVKPTENGKEEGPVPSKQVKVEAVGGASTLNFDSPGSLFKSLISPIKTETFFKEFWE
KKPLLIQRDDPALATYYQSLFRLADLKSLCSQGLYYGRDVNVCRSVSGKKKVLNKDGKVH
FLQLRKDFDQKRATIQFHQPQRFKDELWRVQEKLECYFGSLVGSNVYITPAGSQGLPPHY
DDVEVFILQLEGEKHWRLYPPTVALACEYSVEYEARLGAPTHEFMLKPGDLLYFPRGTIH
QADTPPGLAHSTHVTISTYQNNSWGDFLLDTISGLVFDTAKEDVELRSGIPRQLLMQVET
SGVATRLSSFLRTLADRLEGTKELLSSDMKKDFVIHRLPPYYVGDGTELSTPGGVLPRLH
STVRLQFRDHIILTVGPDQNRSDEAQEKMVYIYHSLKNRRHTHMMGNEETESHGLRFPFS
HVDALKQIWNSSAISVKDLKLTTDEEKENLVLSLWTECLVQVL
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgccaaagaaagtgaagcctaccgagaatgggaaggaagaggggcctgttcccagtaaa
caggtgaaggtggaggctgttggtggggcttccaccttaaactttgatagccccggtagt
ctcttcaaaagtttaatctcacccatcaagacagagacttttttcaaggaattctgggag
aagaagcccctcctcattcagagggatgacccagccctagccacctattaccaatctctc
ttcaggctagcagatttgaagagtctgtgcagccagggtttgtactatggaagagatgtg
aatgtctgccggagtgtcagtgggaagaagaaagttttaaataaagatggcaaagtgcac
tttcttcagctgagaaaagattttgatcagaaaagggcaacaattcagtttcaccaacct
cagagatttaaggatgagctttggagggtccaggagaagctagaatgttactttggctcc
ttggtcggctcaaatgtgtacataacccctgcaggatctcagggcctacctccccattat
gatgatgttgaggttttcatcctgcagctggagggagagaagcactggcggctctatccc
cccacagtggcactggcatgcgagtacagtgtggagtacgaggcccggcttggtgcgcca
acacatgagttcatgttgaagccaggtgatttgttgtactttcccagagggaccattcat
caagcggacactcctccagggttggcccactctactcacgtgaccatcagcacttaccag
aacaattcgtggggagatttccttttggacaccatttcagggcttgtgtttgatactgca
aaggaagatgtggagttacggagtggaataccacggcagctgctgatgcaggtggaaaca
tcaggtgttgcaacaagattaagtagctttctgaggactcttgcagatcgactggagggc
actaaagaactgctttcatcagacatgaagaaggattttgttatacacagacttccccct
tactatgtaggagatggaacagagttgtcaacaccaggtggagtgttaccgaggttgcac
agcacagtgagactgcaatttagagatcacatcatcctcacagtagggccagatcagaat
cgatccgatgaagctcaagaaaagatggtttacatctatcattctctaaagaataggaga
cacacacatatgatgggaaatgaggaaacagagtctcatggacttcgctttcctttctca
catgtggatgcactgaagcaaatttggaacagttcagctatttctgtcaaggacctgaaa
ctaactacagatgaggaaaaggagaacttggtattatccctctggacagaatgtttagta
caagtactttag

DBGET integrated database retrieval system