KEGG   Halorhodospira halophila: Hhal_0019Help
Entry
Hhal_0019         CDS       T00462                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
hha  Halorhodospira halophila
Pathway
hha00860  Porphyrin and chlorophyll metabolism
hha01100  Metabolic pathways
hha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hha00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hhal_0019
Enzymes [BR:hha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     Hhal_0019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ABM60814
UniProt: A1WT02
Position
19722..21116
Genome map
AA seq 464 aa AA seqDB search
MEQRLQFDRDLLRRYDVSGPRYTSYPTAPQFHEGFDAQAYAAAARATNEADQPNPLSVYV
HVPFCRNVCFYCACNKIVTANYSRAQEYLEHVFKEIELQAQLFGEHRRVEQLHLGGGTPN
YLKIDDLGRLVSKLREQFTLDDTDNREFSIEIDPRDVELEDIGRLAELGFNRMSVGVQDF
NEEVQHAVNRVQSAELCRSIIEEGRRHGFRSTNVDLIYGLPKQTVESFEQTLDEVIELRP
ERLAIYNYAHLPHLFKIQRQINEDELPGPEDKLTIFGRTIEKLTDAGYVFIGMDHFALPD
DELAVAQKKGTLHRNFQGYSTRAECDLIALGSTSIGKIGNTYSQNLRDPEEYQQRIANGD
LAVFRGYELNQDDLLRREVIIEVMCHSRLNFADIEARHGIDFNEYFADALERLQPLVEDG
LMEMDDRHLQILPRGRLMLRHVAMAFDAYLEREANEGKRYSRVL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacgtcttcaattcgatcgcgacctgctccgccggtacgatgtaagcgggccc
cgttacacctcgtacccgacggcgccgcaattccatgaagggtttgatgcccaggcctac
gccgcggcagcccgggcgaccaacgaggcggaccagcccaatcccctgtcggtctacgtc
cacgtaccgttctgccgtaacgtgtgcttctactgcgcgtgcaacaagatcgtgacggcg
aactacagccgcgcccaggagtatcttgagcacgtcttcaaggagatcgagctgcaggcg
cagctcttcggcgaacaccgtcgcgttgagcagctccacctcgggggcggcacgccgaat
tacctcaagatcgacgatctggggcgcctggtcagcaagctgcgcgagcagttcaccctc
gacgatacggacaaccgcgagttctctatcgagattgacccgcgagacgtcgagcttgag
gacatcggtcgcctggcggaactcggtttcaatcgtatgagcgtcggcgtgcaggacttc
aacgaggaggtccagcacgcggtcaaccgtgtccagagcgcggaactgtgccgctcgatc
attgaggaggggcgccgccacggcttccgctcgaccaacgtcgacctcatctacggtctg
ccgaagcagacggtggaatccttcgagcagaccctcgacgaggtcatcgagctgcgcccc
gagcgcctggccatctataactacgctcacctcccgcatctattcaagatccagcggcag
atcaacgaggatgagctcccaggccctgaggacaagctcaccatcttcgggcgtaccatc
gagaagctcaccgatgccggctacgtcttcatcggtatggaccacttcgccctgcccgat
gacgagctggccgttgcgcagaagaagggaaccctgcaccggaacttccagggctactcc
acgcgcgcggagtgcgacctcatcgcactgggatccacctccatcggcaagatcggcaac
acctacagtcagaacctgcgggatcccgaggaataccagcagcgcattgccaacggcgat
ctggcggtgttccgtggttacgagctcaaccaggacgatctgctgcgccgggaagtgatc
atcgaggtcatgtgccactcccgcctgaacttcgccgacatcgaggcgcggcacggcatc
gacttcaatgagtacttcgctgacgccctggagcgcctccagcccctggtggaggacggt
ctgatggagatggacgaccgccacctgcagatcctgccgcgggggcgcctgatgctccgc
cacgtcgccatggccttcgatgcctacctggagcgcgaagccaatgaaggcaagcgctat
agccgggtgttgtaa

DBGET integrated database retrieval system