KEGG   Halorhodospira halophila: Hhal_0124Help
Entry
Hhal_0124         CDS       T00462                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hha  Halorhodospira halophila
Pathway
hha00260  Glycine, serine and threonine metabolism
hha00750  Vitamin B6 metabolism
hha01100  Metabolic pathways
hha01110  Biosynthesis of secondary metabolites
hha01120  Microbial metabolism in diverse environments
hha01230  Biosynthesis of amino acids
Module
hha_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hhal_0124
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hhal_0124
Enzymes [BR:hha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hhal_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C DUF4687
Motif
Other DBs
NCBI-ProteinID: ABM60918
UniProt: A1WTA6
Position
complement(142472..143611)
Genome map
AA seq 379 aa AA seqDB search
MPFRPRYTGLIAKYLDRLPISDDARILGLGEGNTPLIQLTRIPAELGRDVDLYVKFEGLN
PTGSFKDRGMTMAVTKAVEQGAKAIICASTGNTSASAAAYAARAGISCFVLIPDGKIAMG
KLAQAIMHGAQVLQIRGNFDAGMRLVKELAEHAPLTIVNSINPYRLQGQKTAAFEIIEEL
ERAPDYHCLPVGNAGNITAHWIGYSECAGRTGDEQLTAACAFCGGQCRYASALVERRPRM
VGYQASGSAPFLRGGPVAEPETVATAIRIGDPQSWDYAQAVREESGGWFDELSDEEILQA
QRMLADHEGVFCEPASATSVAGAMRDIRSGRIPEGSTVVCTLTGHGLKDPDVASAQAGDA
VQTVDADYQAVREAILKRL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcccttccgaccccgttacaccggactgatcgccaagtacctggaccggctgccgatc
agcgacgacgcgcgcatcctcgggctgggtgaggggaatacgccgctgatccagctgacc
cgcatcccggcggagctcggacgggacgtggatctctacgtcaagttcgagggactcaac
ccgacggggtcgttcaaggatcggggcatgaccatggcggtcaccaaggccgtcgagcag
ggcgccaaggcgatcatctgtgcctcgaccggcaacacctccgcttcggcggccgcctat
gcagcccgcgccgggattagctgcttcgtgctcattcccgatggcaagattgccatgggc
aaactggctcaggcgatcatgcacggcgctcaggtgctgcagatccgcggcaatttcgac
gccggcatgcggctggtcaaggagctggccgagcacgcgcccctgacgatcgtcaactcc
atcaatccgtaccgcctgcaggggcagaagaccgccgccttcgagatcatcgaggagctc
gagcgggcgccggattatcactgcctgccggtgggcaacgccggcaacatcaccgcccac
tggatcggctatagcgagtgcgccggccgcacgggcgacgaacagctgacggcggcctgc
gccttctgcggggggcagtgccggtacgcctcggcgctggtggagcggcgcccgcgcatg
gtgggctaccaggccagcggcagcgcgccgttcctgcggggcggcccggtggccgagccg
gagacggtggcgaccgccatccgcatcggtgatccgcagtcgtgggactacgcccaggcc
gtccgcgaggagtccggggggtggttcgatgagctgagcgacgaggagatcctccaggcc
cagcgcatgctcgccgatcacgagggggtcttctgcgagcccgcatcggcgacctcggta
gcgggggccatgcgggatatccgcagcggccgcatccccgaaggcagtacggtggtctgc
accctgaccggccacggcctcaaggatccggatgtggcgagcgcccaggccggcgatgcg
gttcagaccgtggatgccgactaccaggcggttcgcgaggccatcctgaagcggctttga

DBGET integrated database retrieval system